DC900364

Overview
NameDC900364
Unique NameDC900364
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1050
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: TT16_ARATH (Protein TRANSPARENT TESTA 16 OS=Arabidopsis thaliana GN=TT16 PE=1 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.120e-72
Identity = 143/247 (57.89%), Postives = 187/247 (75.71%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEH-DSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHH-------HQVLDHFPFL--GDQQPSSVLQLATNSIPHQIHPYHHLQLAQPNLQD 764
            MGRGKI IK+IEN T RQVTFSKRR GL+KKT ELS+LCDA IGLI+FS+TGKL ++C+E  RM Q+I+R L   G R+P+H D +EQ+ +E+ +LR+ET  L+L +R + G DL SIP ++LD LE +LE SV KVR+RKNEL+QQQL+NL RK RMLEE+N+NMYRW+ EHRAA+E+QQA ++ KP E          ++  ++  FL    QQP+SVLQLAT  +P +I P ++LQLAQPNLQ+
Sbjct:    1 MGRGKIEIKKIENQTARQVTFSKRRTGLIKKTRELSILCDAHIGLIVFSATGKLSEFCSEQNRMPQLIDRYLHTNGLRLPDHHDDQEQLHHEMELLRRETCNLELRLRPFHGHDLASIPPNELDGLERQLEHSVLKVRERKNELMQQQLENLSRKRRMLEEDNNNMYRWLHEHRAAMEFQQAGIDTKPGEYQQFIEQLQCYKPGEYQQFLEQQQQQPNSVLQLAT--LPSEIDPTYNLQLAQPNLQN 245          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: FBP24_PETHY (MADS-box protein FBP24 OS=Petunia hybrida GN=FBP24 PE=1 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 8.594e-65
Identity = 134/262 (51.15%), Postives = 184/262 (70.23%), Query Frame = 3
Query:   51 IMGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHH-HQ-------------VLDHFPFLGDQQ---PSSVLQLATNSI----PHQIHPYHHLQLAQPNLQDPNV 773
            IMGRGKI +KRIEN T+RQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSS GKL +YC++P  M QII R L+ TG  +P  D+R Q+++E+A +R++T  LQLS++RY G+DL    Y++L++LE +LE ++NK+R RK EL+QQQ++NL++ E+MLE+EN +MY+W+  ++   + + AAM+ +    HH HQ             +L HF F GDQ+    S+V   A+ S+     + I PY  LQ + PNLQD +V
Sbjct:    3 IMGRGKIEVKRIENKTSRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSKGKLFEYCSQPHSMSQIISRYLQTTGASLPVEDNRVQLYDEVAKMRRDTLNLQLSLQRYKGDDLSLAQYEELNELEKQLEHALNKIRARKLELMQQQMENLKKTEKMLEKENHDMYQWLMNNQ-MYKQESAAMDHEDHHHHHEHQQAITELNLLGEQPLLSHFTFFGDQEQPSTSTVNHFASISLTSPPANSISPY-RLQPSHPNLQDSHV 262          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: DEF21_ANTMA (MADS-box protein defh21 OS=Antirrhinum majus GN=DEFH21 PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 7.791e-58
Identity = 122/250 (48.80%), Postives = 163/250 (65.20%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTG------TRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQ----EHRAALE--YQQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLATNSIPHQIHPYHHLQLAQPNLQDP 767
            MGRGKI +KRIEN T+RQVTFSKRR+GL+KKTHELSVLCDAQIGLI+FS+ GKL +YCT PF M+QII+R +K  G       R   H   +Q+  EL  +++ET  LQL+++RY G+DL ++ +++L +LE  L+ S+NKVR RK ELL +Q++NL+R E MLE+EN  MY W+     + +A +E  +QQ  M      E    +++ FPF G+      L L         H Y  LQ  QPNLQDP
Sbjct:    1 MGRGKIEVKRIENNTSRQVTFSKRRSGLMKKTHELSVLCDAQIGLIVFSTKGKLTEYCTPPFSMKQIIDRYVKAKGILPEMENRAGPHADNDQVIKELTRMKEETLNLQLNLQRYKGDDLSTVRFEELTELEKLLDQSLNKVRARKLELLHEQMENLKRTEFMLEKENQEMYHWLMSNQIQRQAEVEHHHQQQVMTELKLVEQQQPLMNEFPFFGEDLHLGTLPLL------DTHSY-RLQPTQPNLQDP 243          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: M17_MAIZE (MADS-box protein ZMM17 OS=Zea mays GN=M17 PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.859e-51
Identity = 115/249 (46.18%), Postives = 155/249 (62.25%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAAL--------EYQQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLATNSIPHQIHP---YHHLQLAQPNLQDP 767
            MGRGKI IKRIEN T RQVTFSKRR GLLKK +EL+VLCDA++G++IFSSTGK+ +YC+    + ++IE+    T +   E +  +QI  E+  ++ E  +L+  +RRYTG+DL S+  DD+  LE +LE SV+KVR RK++LL QQLDNLRRKE++LE++N+ +YR I E++ A         E    AM   P    H        + G +  SS   L   S   Q+H       LQ  QPNLQDP
Sbjct:    1 MGRGKIEIKRIENSTNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCSPACSLRELIEQYQHATNSHFEEINHDQQILLEMTRMKNEMEKLETGIRRYTGDDLSSLTLDDVSDLEQQLEYSVSKVRARKHQLLNQQLDNLRRKEQILEDQNTFLYRMINENQQAALTGEVKLGEMAPLAMLQPPPAFAHSAT----AYYGGESSSSGTALQLMSAAPQLHADDLGFRLQPTQPNLQDP 245          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: GGM13_GNEGN (MADS-box protein GGM13 OS=Gnetum gnemon GN=GGM13 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 2.055e-50
Identity = 117/245 (47.76%), Postives = 161/245 (65.71%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFPFLGDQQPSSVLQLATNSIPHQIHPYHH-----LQLAQPNLQDPNV 773
            MGRGKI IKRIEN T RQVTFSKRR GLLKK HELSVLCDA++GLIIFSS+GKL +Y +    M++IIER  KV+G RI E+D+ + ++ E+  ++ E  +LQ ++RR  GEDL S+   +L  L  +LES+ ++VR RKN+L+ QQL+NLRRKER+LE++NS++ R + E +AA+E  Q              +L+   F     P +    A N+ P  +H  HH     LQ  QPNLQ+ ++
Sbjct:    1 MGRGKIEIKRIENTTNRQVTFSKRRGGLLKKAHELSVLCDAELGLIIFSSSGKLFEYSSASSSMKKIIERYQKVSGARITEYDN-QHLYCEMTRMKNENEKLQTNIRRMMGEDLTSLTMTELHHLGQQLESASSRVRSRKNQLMLQQLENLRRKERILEDQNSHLCRLLAEQQAAVEGVQ------------EPLLEFGVFC--PPPDNKTAAAANAGP--LHLGHHLPAFRLQPTQPNLQESSI 228          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD29_ORYSJ (MADS-box transcription factor 29 OS=Oryza sativa subsp. japonica GN=MADS29 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 4.578e-50
Identity = 116/245 (47.35%), Postives = 159/245 (64.90%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQE--HRAAL--EYQQAAMEAKPAEEHHHQVLDHFP-FLGDQQPSSVLQLA--TNSIPHQIHPYHHLQLAQPNLQDP 767
            MGRGKI IKRIEN T RQVTFSKRR GLLKK +EL+VLCDA++G++IFSSTGK+ +YC+    + ++IE    VT T   E +  +QIF E+  +R E  +L   +RR+TG+DL ++   D++ LE +LE SV KVR RK++LL QQLDNLRRKE +LE++NS + R I E  H+AA+     +A +E  P       +L   P + G++  S+ LQL    +++         LQ  QPNLQDP
Sbjct:    1 MGRGKIEIKRIENATNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCSPTCSLRELIEHYQTVTNTHFEEINHDQQIFVEMTRMRNEMEKLDGGIRRFTGDDLSNLTLADINDLEQQLEFSVTKVRARKHQLLNQQLDNLRRKEHILEDQNSFLCRMINENHHQAAVGGGDVKAMVEMAPV----LSMLTAAPAYYGEESSSTALQLTPPLHAVDAAAAAGFRLQPTQPNLQDP 241          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AP32_ASAEU (MADS-box protein AeAP3-2 (Fragment) OS=Asarum europaeum GN=AP3-2 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 2.600e-45
Identity = 106/218 (48.62%), Postives = 148/218 (67.89%), Query Frame = 3
Query:  132 GLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAKPAEEHHHQVLDHFP--FLGDQQP--SSVLQLATNSIPHQIHPYHHLQLAQPNLQDPNV 773
            GLLKK  EL++LCDAQ+G+IIFSS+GK+ ++ + P  M +II+R  K++G   P +D+ +Q++ E+  ++ E  +LQ +MR + GEDL S+  +++ QLE +LE SVNKVR RK +LLQQQLDNLRRKE MLEE+N  +YR IQ+H A      A+ME K  +     +LDHF   +  D Q   SS+LQL+      Q+HP+  LQ AQPNLQD N+
Sbjct:    2 GLLKKARELAILCDAQLGVIIFSSSGKMFEFSSPPISMREIIDRYQKLSGNCAPVYDN-QQVYCEITRMKNEIDKLQATMRHFAGEDLTSLTMNEMLQLEQQLEISVNKVRSRKEQLLQQQLDNLRRKENMLEEQNRELYRVIQDHHA------ASMEQKMVDP---SMLDHFGVFYQDDHQAARSSMLQLSP-----QLHPF-RLQPAQPNLQDANL 203          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD31_ORYSJ (MADS-box transcription factor 31 OS=Oryza sativa subsp. japonica GN=MADS31 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 6.202e-39
Identity = 77/148 (52.03%), Postives = 108/148 (72.97%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTRIPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQL 497
            MGRG++ +K+IENPT RQVTFSKRR GLLKK +EL++LCDAQIG+I+FS TGK+ +Y + P+R+  I +R LK   TR  E D +++I  E+  ++ E  RL++ MR+Y G+DL S+   D+  LE ++E S+ KVR RK +LL QQL
Sbjct:    1 MGRGRVELKKIENPTNRQVTFSKRRMGLLKKANELAILCDAQIGVIVFSGTGKMYEYSSPPWRIANIFDRYLKAPSTRFEEMDVQQRIIQEMTRMKDENNRLRIIMRQYMGDDLASLTLQDVSNLEQQIEFSLYKVRLRKQQLLDQQL 148          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: MAD30_ORYSJ (MADS-box transcription factor 30 OS=Oryza sativa subsp. japonica GN=MADS30 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 4.445e-37
Identity = 82/172 (47.67%), Postives = 121/172 (70.35%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIER-RLKVTGTRIPE-HDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSI-PYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWI 560
            MG+GKI +KRIE+ T RQVTFSKRRAG LKK +EL+VLCDAQ+G+++FS  GKL  +C+ P  + ++  R  +    TR+ E +   EQ+  E+  LR E  +L+ S+RR TGEDL S+   D+L QL+ +LESS++KV  RK+EL+ QQL+++RR  + + E+N+ + R +
Sbjct:    1 MGQGKIEMKRIEDATRRQVTFSKRRAGFLKKANELAVLCDAQVGVVVFSDKGKLFDFCSPPVILMELFHRYEITTRNTRLQETNRDDEQMVMEITRLRNEIDQLEASLRRQTGEDLSSVSTVDELSQLQLQLESSLSKVHARKDELMSQQLEDMRRMHQTVHEQNNFLCRMV 172          
BLAST of DC900364 vs. ExPASy Swiss-Prot
Match: AP1_SINAL (Floral homeotic protein APETALA 1 OS=Sinapis alba GN=AP1 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.881e-36
Identity = 90/250 (36.00%), Postives = 140/250 (56.00%), Query Frame = 3
Query:   54 MGRGKIAIKRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCTEPFRMEQIIERRLKVTGTR----IPEHDSREQIFNELAVLRKETRRLQLSMRRYTGEDLGSIPYDDLDQLEHELESSVNKVRDRKNELLQQQLDNLRRKERMLEEENSNMYRWIQEHRAALEYQQAAMEAK-----------PAEEHHHQVLDH--FPFL---GDQQPSSVLQLATNSIPHQIHPYHHLQL 743
            MGRG++ +KRIEN   RQVTFSKRRAGLLKK HE+SVLCDA++ L++FS  GKL +Y T+   ME+I+ER  + +        PE D       E   L+ +   L+ + R Y GEDL ++   +L  LE +L++++  +R RKN+L+   ++ L+RKE+ ++E+NS + + I+E    L  QQ   + +           P +  H  +L H   PFL   G  Q    +++  N +   + P ++  L
Sbjct:    1 MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYSTDSC-MEKILERYERYSYAERQLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSSKELQNLEQQLDTALKHIRSRKNQLMHDSINELQRKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNHGHNMPPPPPPQQIQHPYMLSHQPSPFLNMGGLYQEEDPMEMRRNDLDLSLEPVYNCNL 249          
The following BLAST results are available for this feature:
BLAST of DC900364 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 117
Match NameE-valueIdentityDescription
TT16_ARATH1.120e-7257.89Protein TRANSPARENT TESTA 16 OS=Arabidopsis thalia... [more]
FBP24_PETHY8.594e-6551.15MADS-box protein FBP24 OS=Petunia hybrida GN=FBP24... [more]
DEF21_ANTMA7.791e-5848.80MADS-box protein defh21 OS=Antirrhinum majus GN=DE... [more]
M17_MAIZE1.859e-5146.18MADS-box protein ZMM17 OS=Zea mays GN=M17 PE=2 SV=... [more]
GGM13_GNEGN2.055e-5047.76MADS-box protein GGM13 OS=Gnetum gnemon GN=GGM13 P... [more]
MAD29_ORYSJ4.578e-5047.35MADS-box transcription factor 29 OS=Oryza sativa s... [more]
AP32_ASAEU2.600e-4548.62MADS-box protein AeAP3-2 (Fragment) OS=Asarum euro... [more]
MAD31_ORYSJ6.202e-3952.03MADS-box transcription factor 31 OS=Oryza sativa s... [more]
MAD30_ORYSJ4.445e-3747.67MADS-box transcription factor 30 OS=Oryza sativa s... [more]
AP1_SINAL2.881e-3636.00Floral homeotic protein APETALA 1 OS=Sinapis alba ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900364 VSS Citrus sinensis cDNA clone VS28932 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900364 ID=DC900364|Name=DC900364|organism=Citrus sinensis|type=EST|length=1050bp
CGGCACGAGTTACAAGCAAAGCAAGAGAAAGCGAACAAGAAAAGATCAGA
ATAATGGGACGTGGGAAGATAGCGATCAAGAGGATTGAGAACCCGACGAC
GAGGCAAGTAACCTTCTCGAAACGGAGAGCTGGGCTTTTGAAGAAGACCC
ATGAACTCTCAGTGCTTTGTGATGCTCAAATTGGCCTCATCATCTTCTCA
AGTACCGGAAAATTGTGCCAGTACTGCACTGAGCCTTTCAGAATGGAGCA
AATCATTGAGAGGCGCCTCAAAGTTACAGGGACTCGCATCCCTGAGCATG
ATAGCCGGGAACAAATATTCAATGAGTTGGCGGTTCTGAGAAAAGAAACC
CGCCGCCTTCAGCTGAGTATGCGACGCTACACTGGTGAGGACTTGGGTTC
TATACCTTATGATGATCTCGATCAACTTGAACATGAGCTTGAAAGCTCTG
TTAACAAGGTCCGAGATCGCAAGAATGAGCTTCTTCAACAACAGCTGGAT
AATCTTCGTAGGAAGGAGCGAATGCTGGAGGAAGAGAACAGCAACATGTA
CCGTTGGATTCAGGAGCATAGGGCAGCATTGGAGTATCAGCAAGCTGCAA
TGGAAGCAAAGCCAGCTGAGGAGCATCATCATCAAGTCTTGGATCATTTT
CCATTCTTGGGAGATCAACAACCCAGTAGTGTGCTTCAGCTTGCAACCAA
CAGTATCCCTCATCAAATTCACCCTTATCACCATCTTCAGCTTGCTCAGC
CCAACCTTCAGGATCCCAATGTCTAGTATCAGCTTAAGAAGGATGTCCGA
AAGAGGTTGCGAAAGAGTAGATGATATAATCATTATGAAGATGACTCATA
ATTATCTCCTGGTTATTAATTACCTTATATAGTTTGCAGTAATTAAATTA
TTATTTTATGTTTTAGAAGCTACGAATGATCTGCTCGCTATGTGTGTTCC
TCATATTTATAACTCTTTGTATATGTATTGAGATATGTGACTTCAAACAA
TTGTACTGTGGTATGTTTTAGACATGAAAAAGTACTTGAATTTCTGCCGT
back to top