DC900348

Overview
NameDC900348
Unique NameDC900348
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length873
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900348_ssr731 microsatellite DC900348_ssr731:731..742. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig8249 contig Csv1_Contig8249:779..1651. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_PRUAV (Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 7.926e-87
Identity = 156/230 (67.83%), Postives = 171/230 (74.35%), Query Frame = 3
Query:    3 MVNIPNFRKILGEIKQAESVPPVQSAKKPTQSXXXXXXXXXXXXXXXXXXXXXXXXXXDAGXXXXXXXXXXXXXXXXXXSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK 692
            +VN P F+K+LG++KQ ESVPPV SAKKP+Q                                                S M+LD+WKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFC+YKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQ IP F+M ECYDMELY+W KVD++DE QKERV+Q+IED EPFEGEALLDAKCFK
Sbjct:  193 LVNQPKFKKVLGDVKQTESVPPVPSAKKPSQPKETKSKAKEEPKKEAKKEPAKPKAEAAEEVEEAPKPKPKNPLDLLPPSNMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTKVDLSDENQKERVNQVIEDQEPFEGEALLDAKCFK 422          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G2_ORYSJ (Elongation factor 1-gamma 2 OS=Oryza sativa subsp. japonica GN=Os02g0220500 PE=2 SV=2)

HSP 1 Score: 314.309 bits (804), Expect = 5.680e-85
Identity = 157/230 (68.26%), Postives = 169/230 (73.48%), Query Frame = 3
Query:    3 MVNIPNFRKILGEIKQAESVPPVQSAKKPTQSXXXXXXXXXXXXXXXXXXXXXXXXXXDAGXXXXXXXXXXXXXXXXXXSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK 692
            MVN PNF+K+LG++KQAESVPPVQ    P +                           +                    SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVGGFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG  IP+F+M E YDMELY+W KVDI+DEAQKERVS MIED EPFEGE+LLDAKCFK
Sbjct:  193 MVNQPNFKKVLGDVKQAESVPPVQKKAPPPKEQKPKEAKKEAPKEAPKPKAVEKPEEEEEAPKPKPKNPLDLLPP----SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDISDEAQKERVSAMIEDLEPFEGESLLDAKCFK 418          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G1_ORYSJ (Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 1.399e-83
Identity = 157/231 (67.97%), Postives = 170/231 (73.59%), Query Frame = 3
Query:    3 MVNIPNFRKILGEIKQAESVPPVQS-AKKPTQSXXXXXXXXXXXXXXXXXXXXXXXXXXDAGXXXXXXXXXXXXXXXXXXSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK 692
            MVN PNF+K++G++KQA+SVP VQ  A  P +                           +A                   SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVGGFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG  IP+F+M E YDMELY+W KVDI+DEAQKERVS MIED EPFEGEALLDAKCFK
Sbjct:  193 MVNQPNFKKVMGDVKQADSVPQVQKKAAAPKEQKPKEAKKEAPKEAPKPKAAEKPEEEEEA-----PKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDISDEAQKERVSAMIEDLEPFEGEALLDAKCFK 418          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G3_ORYSJ (Elongation factor 1-gamma 3 OS=Oryza sativa subsp. japonica GN=Os06g0571400 PE=2 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 3.117e-83
Identity = 153/230 (66.52%), Postives = 167/230 (72.61%), Query Frame = 3
Query:    3 MVNIPNFRKILGEIKQAESVPPVQSAKKPTQSXXXXXXXXXXXXXXXXXXXXXXXXXXDAGXXXXXXXXXXXXXXXXXXSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK 692
            MVN PNF+K++G+ KQAESVPPVQ    P +                            +                   SKMILDEWKRLYSNTKTNFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKVGGFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRGQ IP+F+M E YDMELY+W KVD++DEAQKERV+ MIED EPFEGE LLDAKCFK
Sbjct:  193 MVNQPNFKKVIGDFKQAESVPPVQKKAAPPKESKAKEAKKEAPKEAPKPKVEA------SEEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDLSDEAQKERVNAMIEDQEPFEGEDLLDAKCFK 416          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G2_ARATH (Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana GN=At1g57720 PE=2 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.448e-80
Identity = 151/230 (65.65%), Postives = 165/230 (71.74%), Query Frame = 3
Query:    3 MVNIPNFRKILGEIKQAESVPPVQSAKKPTQSXXXXXXXXXXXXXXXXXXXXXXXXXXDAGXXXXXXXXXXXXXXXXXXSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK 692
            MVN P F+K+LG+ KQ E+VPPV + K P  +                           A                   S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVTLNKVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG  IP+FIM E YDMELY+W KVDI+DEAQKERVSQMIED EPFEGEALLDAKCFK
Sbjct:  193 MVNQPEFKKVLGDAKQTEAVPPVPTKKAPQPAKPKEEPKKAAPVAEAPKP---------AEEEEAPKPKAKNPLDLLPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK 413          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G1_ARATH (Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana GN=At1g09640 PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 3.225e-80
Identity = 150/230 (65.22%), Postives = 165/230 (71.74%), Query Frame = 3
Query:    3 MVNIPNFRKILGEIKQAESVPPVQSAKKPTQSXXXXXXXXXXXXXXXXXXXXXXXXXXDAGXXXXXXXXXXXXXXXXXXSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK 692
            +VN PNF K+LG++KQ E+VPP+ S K    +                           A                   S M+LD+WKRLYSNTK+NFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVTLNKVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG  IP+FIM E YDMELY+W KVDI+DEAQKERVSQMIED EPFEGEALLDAKCFK
Sbjct:  193 VVNQPNFTKVLGDVKQTEAVPPIASKKAAQPAKPKEEPKKKEAPVAEAPKL--------AEEEEAPKPKAKNPLDLLPPSPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK 414          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_TRYCR (Elongation factor 1-gamma OS=Trypanosoma cruzi PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.270e-25
Identity = 62/151 (41.06%), Postives = 93/151 (61.59%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECYDMELYDWKKVDINDEAQKERVSQMIEDHEPFEGEALLDAKCFK 692
            S  +LD +KR YSNT T  R VA   F+  YD  GY+ ++C YKYN++N + F+T N + G+ QRM+  RKYAFG  L+IG E    +  LW+FRG+ +P  I+ +  D EL+DW++V  +  AQ+ER++  +    P     +L+ + FK
Sbjct:  265 SPFVLDAFKREYSNTDT--RTVAAPYFFQHYDAAGYTTFWCRYKYNEDNKMQFMTANLIRGWFQRMEHVRKYAFGVALIIGEERRHDIVALWVFRGRGMPA-IVEDVEDTELFDWEEV-ADVAAQRERITDYLSWEGPTIPRPVLEGRVFK 411          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G_CARAU (Elongation factor 1-gamma OS=Carassius auratus GN=eef1g PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 8.074e-23
Identity = 54/144 (37.50%), Postives = 90/144 (62.50%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECY--DMELYDWKKVDINDEAQKERVSQMIEDHEPFEGE 665
            S  ++DE+KR YSN  T    VA+  FWD +D EG+S+W+ +Y++ +E T+SF++ N + G  QR+D  RK AF  +++ G+     + G+W+FRGQ +  F + E +  D E Y W+K+D++ E  K     M++++  +EGE
Sbjct:  291 SSFVMDEFKRKYSNEDT--LTVALPYFWDHFDREGFSIWYAEYRFPEELTMSFMSCNLITGMFQRLDKLRKNAFASVILFGANNDSCISGIWVFRGQEL-AFTLSEDWQIDYESYTWRKLDVDSEECK----TMVKEYFAWEGE 427          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G1_YEAST (Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae GN=CAM1 PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 1.055e-22
Identity = 62/156 (39.74%), Postives = 89/156 (57.05%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQ-VIPQFIMYECYDMELYDWKKVDINDEAQKERVSQMIEDHEPF----EGEALLDAKCFK 692
            S  +LD+WKR YSN  T  R VA+  FW+ Y+PE YSLW   YKYNDE T++F++ N VGGF  R+  + KY FG ++V G      + G  + RGQ  +P F +    D E YD+ K+D  ++  KE ++ M    +P     E + ++D K  K
Sbjct:  264 STFVLDDWKRKYSNEDT--RPVALPWFWEHYNPEEYSLWKVTYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDYVPAFDV--APDWESYDYAKLDPTNDDDKEFINNMWAWDKPVSVNGEPKEIVDGKVLK 415          
BLAST of DC900348 vs. ExPASy Swiss-Prot
Match: EF1G2_YEAST (Elongation factor 1-gamma 2 OS=Saccharomyces cerevisiae GN=TEF4 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.234e-22
Identity = 62/156 (39.74%), Postives = 87/156 (55.77%), Query Frame = 3
Query:  240 SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQ-VIPQFIMYECYDMELYDWKKVDINDEAQKERVSQMIEDHEPF----EGEALLDAKCFK 692
            S  +LD+WKR YSN  T  R VA+  FW+ Y+PE YS+W   YKYNDE T++F++ N VGGF  R+  + KY FG ++V G      + G  + RGQ   P F +    D E Y++ K+D   E  KE V+ M    +P     E + ++D K  K
Sbjct:  261 STFVLDDWKRKYSNDDT--RPVALPWFWEHYNPEEYSIWKVGYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDFAPAFDV--APDWESYEYTKLDPTKEEDKEFVNNMWAWDKPVVVNGEDKEIVDGKVLK 412          
The following BLAST results are available for this feature:
BLAST of DC900348 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
EF1G_PRUAV7.926e-8767.83Elongation factor 1-gamma OS=Prunus avium PE=2 SV=... [more]
EF1G2_ORYSJ5.680e-8568.26Elongation factor 1-gamma 2 OS=Oryza sativa subsp.... [more]
EF1G1_ORYSJ1.399e-8367.97Elongation factor 1-gamma 1 OS=Oryza sativa subsp.... [more]
EF1G3_ORYSJ3.117e-8366.52Elongation factor 1-gamma 3 OS=Oryza sativa subsp.... [more]
EF1G2_ARATH1.448e-8065.65Probable elongation factor 1-gamma 2 OS=Arabidopsi... [more]
EF1G1_ARATH3.225e-8065.22Probable elongation factor 1-gamma 1 OS=Arabidopsi... [more]
EF1G_TRYCR2.270e-2541.06Elongation factor 1-gamma OS=Trypanosoma cruzi PE=... [more]
EF1G_CARAU8.074e-2337.50Elongation factor 1-gamma OS=Carassius auratus GN=... [more]
EF1G1_YEAST1.055e-2239.74Elongation factor 1-gamma 1 OS=Saccharomyces cerev... [more]
EF1G2_YEAST5.234e-2239.74Elongation factor 1-gamma 2 OS=Saccharomyces cerev... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900348 VSS Citrus sinensis cDNA clone VS28907 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900348 ID=DC900348|Name=DC900348|organism=Citrus sinensis|type=EST|length=873bp
CAATGGTTAACATACCAAATTTCCGCAAGATATTGGGAGAGATAAAGCAA
GCAGAATCTGTCCCTCCTGTTCAGTCAGCGAAGAAGCCCACGCAGTCAAA
AGAGCCTGCAAAACCCAAGGCCCAGGCTGAGCCAAAGAAAGAGGCTGCAA
ANNAAACAGCAAAACCTAAAGTTGAAGACGCTGGTGAGGAAGAGGCACCA
AAGCCCAAGCCAAAGAATCCACTTGACCTTTTGCCTCCCAGCAAGATGAT
TTTGGATGAGTGGAAGAGGCTGTACTCAAACACAAAGACCAACTTTCGTG
AGGTTGCCATTAAAGGATTTTGGGACATGTATGATCCGGAGGGCTACTCT
CTTTGGTTCTGTGATTACAAGTACAATGATGAGAATACAGTCTCATTTGT
GACTTTGAACAAAGTGGGCGGATTCCTGCAGCGAATGGACTTGGCTCGTA
AGTATGCTTTTGGGAAGATGCTGGTTATTGGCTCGGAGCCACCTTTCAAG
GTAAAGGGTTTGTGGCTTTTCCGTGGACAAGTGATTCCTCAATTTATAAT
GTACGAGTGTTACGACATGGAGTTGTATGATTGGAAGAAGGTGGACATCA
ATGATGAAGCTCAGAAGGAGCGTGTAAGCCAGATGATCGAAGATCATGAA
CCTTTCGAGGGTGAGGCCTTGTTAGATGCCAAGTGCTTCAAGTGAGATCA
TCCAGATGGACCAGACCGGGGAAGTAGCTGGTGTGTGTGTGTAATGCTGT
TGCAATCATTTAAGTTTTCTAATTTTTCATCTTTAGTTTTGTGCTGTTAG
CAAATTGACCCTATTTAAGCATTCAATTGACTTTGATTTAAATACATCAG
AACTTTCTAGTTAATTTTCATAT
back to top