DC900345

Overview
NameDC900345
Unique NameDC900345
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1136
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5659 contig Csv1_Contig5659:1..1137. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900345 vs. ExPASy Swiss-Prot
Match: CIPKN_ARATH (CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1)

HSP 1 Score: 422.935 bits (1086), Expect = 1.666e-117
Identity = 203/255 (79.61%), Postives = 230/255 (90.20%), Query Frame = 1
Query:    1 INNKGYDGAKADLWSCGVILYVLMAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEWFKKGYKPPSFEQPNIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGLNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKSGDE 765
            INNKGYDGAKADLWSCGVIL+VLMAGYLPFE+SNL +LYKKIFKA+F  PPWFS SAKKLI RILDPNP TRIT AEVIENEWFKKGYK P FE  ++ LDDVD+IF++S +S+NLVVERREEG   P+TMNAFELISTSQGLNL SLFEKQMGLVKR+TRFTSK   NEI++KIE AA+P+GFDVK NN+K+KL GEK+GRKG L+VATE+F+VAPSLYMVE+RKSGGDTLEFHKFYKNL+TGLKD+VWK+ DE
Sbjct:  203 INNKGYDGAKADLWSCGVILFVLMAGYLPFEDSNLTSLYKKIFKAEFTCPPWFSASAKKLIKRILDPNPATRITFAEVIENEWFKKGYKAPKFENADVSLDDVDAIFDDSGESKNLVVERREEGLKTPVTMNAFELISTSQGLNLGSLFEKQMGLVKRKTRFTSKSSANEIVTKIEAAAAPMGFDVKTNNYKMKLTGEKSGRKGQLAVATEVFQVAPSLYMVEMRKSGGDTLEFHKFYKNLTTGLKDIVWKTIDE 457          
BLAST of DC900345 vs. ExPASy Swiss-Prot
Match: CIPKN_ORYSJ (CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 9.165e-108
Identity = 195/262 (74.43%), Postives = 220/262 (83.97%), Query Frame = 1
Query:    1 INNKGYDGAKADLWSCGVILYVLMAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEWFKKGYKPPSFEQPNIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGLNLSSLFEKQ-MGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWK------SGDE 765
            INNKGYDGAKADLWSCGVIL+VLMAGYLPFE+SNLM+LYKKIFKADF  P WFSTSAKKLI +ILDPNP TRIT+AE+I NEWFKKGY+PP FE  +++LDD++SIFNES D   LVVERREE    P  MNAFELISTSQGLNL +LFEKQ  G VKRETRF S+ P NEI+SKIE AA P+GF+V+K N+KLKLQGE  GRKG L++ATE+FEV PSLYMVELRKS GDTLEFHKFY N+S GLKDV+WK      +GDE
Sbjct:  185 INNKGYDGAKADLWSCGVILFVLMAGYLPFEDSNLMSLYKKIFKADFSCPSWFSTSAKKLIKKILDPNPSTRITIAELINNEWFKKGYQPPRFETADVNLDDINSIFNESGDQTQLVVERREE---RPSVMNAFELISTSQGLNLGTLFEKQSQGSVKRETRFASRLPANEILSKIEAAAGPMGFNVQKRNYKLKLQGENPGRKGQLAIATEVFEVTPSLYMVELRKSNGDTLEFHKFYHNISNGLKDVMWKPESSIIAGDE 443          
BLAST of DC900345 vs. ExPASy Swiss-Prot
Match: CIPK9_ARATH (CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2)

HSP 1 Score: 347.436 bits (890), Expect = 8.898e-95
Identity = 166/254 (65.35%), Postives = 217/254 (85.43%), Query Frame = 1
Query:    1 INNKGYDGAKADLWSCGVILYVLMAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEWFKKGYKPPSFEQPNIDL--DDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGLNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKS 756
            +++KGYDGA AD+WSCGVIL+VLMAGYLPF+E NLM LYK+I KA+F  PPWFS  AK++I RIL+PNP+TRI++AE++E+EWFKKGYKPPSF+Q + D+  DDVD+ F+ S +   LV E++E+    P++MNAFELIS+S   +L +LFEKQ  LVK+ETRFTS+R  +EI+SK+EE A PLGF+V+K+N+K+K++G+K+GRKG LSVATE+FEVAPSL++VELRK+GGDTLEFHKFYKN S+GLKDVVW +
Sbjct:  191 LSDKGYDGAAADVWSCGVILFVLMAGYLPFDEPNLMTLYKRICKAEFSCPPWFSQGAKRVIKRILEPNPITRISIAELLEDEWFKKGYKPPSFDQDDEDITIDDVDAAFSNSKEC--LVTEKKEK----PVSMNAFELISSSSEFSLENLFEKQAQLVKKETRFTSQRSASEIMSKMEETAKPLGFNVRKDNYKIKMKGDKSGRKGQLSVATEVFEVAPSLHVVELRKTGGDTLEFHKFYKNFSSGLKDVVWNT 438          
BLAST of DC900345 vs. ExPASy Swiss-Prot
Match: CIPK9_ORYSJ (CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 5.052e-90
Identity = 166/252 (65.87%), Postives = 204/252 (80.95%), Query Frame = 1
Query:    7 NKGYDGAKADLWSCGVILYVLMAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEWFKKGYKPPSFEQ-PNIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGLNLSSLFEKQM-GLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKS 756
            +KGYDG  AD+WSCG+IL+VLMAGYLPF++ NLM LYK I KA    P WFS+ AKK I RILDPNP TRIT+A+++E++WFKK YKPP FEQ  ++ LDDVD+ F+ S +  NLV E+RE+    P +MNAF LIS SQG NL +LFEK+M G+VKRET FTS+    EI+SKIEEA  PLGF+V+K N+K+KL+G+KTGRKG+LSVATE+FEVAPSL+MVELRK+GGDTLEFH FY N S+ LKD+VWKS
Sbjct:  201 DKGYDGMAADVWSCGIILFVLMAGYLPFDDPNLMTLYKLICKAKVSCPHWFSSGAKKFIKRILDPNPCTRITIAQILEDDWFKKDYKPPLFEQGEDVSLDDVDAAFDCSEE--NLVAEKREK----PESMNAFALISRSQGFNLGNLFEKEMMGMVKRETSFTSQCTPQEIMSKIEEACGPLGFNVRKQNYKMKLKGDKTGRKGYLSVATEVFEVAPSLHMVELRKTGGDTLEFHNFYNNFSSELKDIVWKS 446          
BLAST of DC900345 vs. ExPASy Swiss-Prot
Match: CIPKW_ORYSJ (CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2)

HSP 1 Score: 323.939 bits (829), Expect = 1.053e-87
Identity = 164/255 (64.31%), Postives = 203/255 (79.61%), Query Frame = 1
Query:    1 INNKGYDGAKADLWSCGVILYVLMAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEWFKKGYKPPSF-EQPNIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGLNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKSGD 762
            + ++GYDGA ADLWSCGVIL+VL+AGYLPFE+SNLM LYKKI  A+F  PPW S  AK+L++RILDPNP+TR+T+ E++E+EWFKKGYK P F E+ +  LDDV ++FN+S +    V E++EE    P  +NAFELIS S GLNL +LF+ +    KRETRFTSK P  EI+ KIEEAA PLGFDV+K N+KL+L+  K GRKG+L+VATEI +VAPSL+MVE+RK+ GDTLEFHKFYKNLS  LKDVVWKS D
Sbjct:  185 LEDQGYDGAMADLWSCGVILFVLLAGYLPFEDSNLMTLYKKISNAEFTFPPWTSFPAKRLLTRILDPNPMTRVTIPEILEDEWFKKGYKRPEFDEKYDTTLDDVYAVFNDSEEHH--VTEKKEE----PEALNAFELISMSAGLNLGNLFDSEQEF-KRETRFTSKCPPKEIVRKIEEAAKPLGFDVQKKNYKLRLEKVKAGRKGNLNVATEILQVAPSLHMVEVRKAKGDTLEFHKFYKNLSRTLKDVVWKSDD 432          
BLAST of DC900345 vs. ExPASy Swiss-Prot
Match: CIPKX_ORYSJ (CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 4.426e-86
Identity = 167/271 (61.62%), Postives = 204/271 (75.28%), Query Frame = 1
Query:    1 INNKGYDGAKADLWSCGVILYVLMAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEWFKKGYKPPSF-EQPNIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGLNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNN----------------FKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKSGD 762
            + ++GYDGA ADLWSCGVIL+VL+AGYLPFE+SNLM LYKKI  A+F  PPW S  AK+L++RILDPNP+TRIT+ E++E+EWFKKGYK P F E+ +  LDDVD++FN+S +    V E++EE    P  +NAFELIS S GLNL +LF+ +    KRETRFTSK P  EI+ KIEEAA PLGFDV+K N                FKL+L+  K GRKG+L+VATEI +VAPSL+MVE+RK+ GDTLEFHKFYKNLS  LKDVVWKS D
Sbjct:  185 LEDQGYDGAMADLWSCGVILFVLLAGYLPFEDSNLMTLYKKISNAEFTFPPWTSFPAKRLLTRILDPNPMTRITIPEILEDEWFKKGYKRPEFDEKYDTTLDDVDAVFNDSEEHH--VTEKKEE----PEALNAFELISMSAGLNLGNLFDSEQEF-KRETRFTSKCPPKEIVRKIEEAAKPLGFDVQKKNYKICSPCLTTICMNIPFKLRLEKVKAGRKGNLNVATEILQVAPSLHMVEVRKAKGDTLEFHKFYKNLSRTLKDVVWKSDD 448          
BLAST of DC900345 vs. ExPASy Swiss-Prot
Match: CIPK3_ARATH (CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2)

HSP 1 Score: 315.849 bits (808), Expect = 2.869e-85
Identity = 155/255 (60.78%), Postives = 199/255 (78.04%), Query Frame = 1
Query:    1 INNKGYDGAKADLWSCGVILYVLMAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEWFKKGYKPPSFEQ-PNIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGLNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKSGD 762
            +N++GYDGA AD+WSCGV+LYVL+AGYLPF++SNLM LYKKI   +F  PPW S  A KLI+RILDPNP+TR+T  EV E+EWFKK YKPP FE+  + ++DD+D++F +S    +LV E+REE P A   +NAFE+IS S+GLNL +LF+ +    KRETR T +   NEII KIEEAA PLGFDV+K N+K++L+  K GRKG+L+VATEIF+VAPSL+MV++ KS GDTLEFHKFYK LS  L+ VVW + +
Sbjct:  186 LNDRGYDGATADMWSCGVVLYVLLAGYLPFDDSNLMNLYKKISSGEFNCPPWLSLGAMKLITRILDPNPMTRVTPQEVFEDEWFKKDYKPPVFEERDDSNMDDIDAVFKDS--EEHLVTEKREEQPAA---INAFEIISMSRGLNLENLFDPEQEF-KRETRITLRGGANEIIEKIEEAAKPLGFDVQKKNYKMRLENVKAGRKGNLNVATEIFQVAPSLHMVQVSKSKGDTLEFHKFYKKLSNSLEQVVWTNNE 434          
BLAST of DC900345 vs. ExPASy Swiss-Prot
Match: CIPKV_ORYSJ (CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 3.747e-85
Identity = 157/256 (61.33%), Postives = 199/256 (77.73%), Query Frame = 1
Query:    1 INNKGYDGAKADLWSCGVILYVLMAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEWFKKGYKPPSF-EQPNIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGLNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKSGDE 765
            I ++GYDGA AD+WSCGVILYVL+AG+LPFE+ N++ALYKKI +A F  P WFST AKKLI+RILDPNP TRIT+++++E+ WFKKGYKPP F E+     DDVD+ F +S D        +EE    P +MNAFELIS +Q LNL +LFE +    KRETRFTS+ P  EII+KIEEAA PLGFD++K N+K++++  K GRKG+L+VATE+F+VAPSL++VEL+K+ GDTLEF KFY+ LST LKDVVWK   E
Sbjct:  192 IEDRGYDGAAADIWSCGVILYVLLAGFLPFEDDNIIALYKKISEAQFTCPSWFSTGAKKLITRILDPNPTTRITISQILEDPWFKKGYKPPVFDEKYETSFDDVDAAFGDSEDR-----HVKEETEDQPTSMNAFELISLNQALNLDNLFEAKKE-YKRETRFTSQCPPKEIITKIEEAAKPLGFDIQKKNYKMRMENLKAGRKGNLNVATEVFQVAPSLHVVELKKAKGDTLEFQKFYRTLSTQLKDVVWKCDGE 441          
BLAST of DC900345 vs. ExPASy Swiss-Prot
Match: CIPKQ_ARATH (CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=2 SV=2)

HSP 1 Score: 315.464 bits (807), Expect = 3.747e-85
Identity = 154/257 (59.92%), Postives = 200/257 (77.82%), Query Frame = 1
Query:    1 INNKGYDGAKADLWSCGVILYVLMAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEWFKKGYKPPSFEQ-PNIDLDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGLNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKSGDET 768
            +N++GYDGA ADLWSCGVIL+VL+AGYLPFE+SNLM LYKKI   ++  PPW S  AK LI RILDPNP+TRIT+ EV+ + WFKK YKP  FE+    +LDDVD++F +S +    V E++EE    P +MNAFELIS S+ L+L +LFE++ G  KRETRF +K   N+++ KIEEA+ PLGFD++K N+K++L+    GRKG+L VATEIF+V+PSL+M+E+RK+ GDTLEFHKFYK LST L DVVWKSG+ +
Sbjct:  185 LNDQGYDGATADLWSCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWFKKNYKPAVFEEKEEANLDDVDAVFKDSEEHH--VTEKKEE---QPTSMNAFELISMSRALDLGNLFEEEEGF-KRETRFAAKGAANDLVQKIEEASKPLGFDIQKKNYKMRLENVTAGRKGNLRVATEIFQVSPSLHMIEVRKTKGDTLEFHKFYKKLSTSLNDVVWKSGESS 435          
BLAST of DC900345 vs. ExPASy Swiss-Prot
Match: CIPK3_ORYSJ (CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 2.434e-76
Identity = 145/255 (56.86%), Postives = 190/255 (74.51%), Query Frame = 1
Query:    1 INNKGYDGAKADLWSCGVILYVLMAGYLPFEESNLMALYKKIFKADFKSPPWFSTSAKKLISRILDPNPVTRITMAEVIENEWFKKGYKPPSFEQPNID-LDDVDSIFNESMDSRNLVVERREEGPVAPLTMNAFELISTSQGLNLSSLFEKQMGLVKRETRFTSKRPVNEIISKIEEAASPLGFDVKKNNFKLKLQGEKTGRKGHLSVATEIFEVAPSLYMVELRKSGGDTLEFHKFYKNLSTGLKDVVWKSGD 762
            I +KGYDGA ADLWSCGVIL+VL+AGYLPFE+ N+++LY KI  A F  P WFS  AK+LI+RILDPNP TRIT ++V++++WFKKGY+ P F+        DV   F +S +    V E  EE    P  MNAFELIS ++GLNL + FE      KRETRFTS+ P  EII++IEEAA+ LGF+++K N++++++  K GRKGHL++ATE+F+VAPSL++VEL+K+ GDTLEF KFY+ LST LKDVVW+  D
Sbjct:  191 IEDKGYDGALADLWSCGVILFVLLAGYLPFEDENIVSLYNKISGAQFTCPSWFSAEAKRLIARILDPNPATRITTSQVLQDQWFKKGYESPVFDDKYYPYFHDVYDAFGDSEEKH--VKEAMEE---QPTLMNAFELISLNKGLNLDNFFESDK-KYKRETRFTSQCPPKEIINRIEEAANLLGFNIQKRNYRMRMENIKEGRKGHLNIATEVFQVAPSLHVVELKKAKGDTLEFQKFYQTLSTQLKDVVWELED 439          
The following BLAST results are available for this feature:
BLAST of DC900345 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 168
Match NameE-valueIdentityDescription
CIPKN_ARATH1.666e-11779.61CBL-interacting serine/threonine-protein kinase 23... [more]
CIPKN_ORYSJ9.165e-10874.43CBL-interacting protein kinase 23 OS=Oryza sativa ... [more]
CIPK9_ARATH8.898e-9565.35CBL-interacting serine/threonine-protein kinase 9 ... [more]
CIPK9_ORYSJ5.052e-9065.87CBL-interacting protein kinase 9 OS=Oryza sativa s... [more]
CIPKW_ORYSJ1.053e-8764.31CBL-interacting protein kinase 32 OS=Oryza sativa ... [more]
CIPKX_ORYSJ4.426e-8661.62CBL-interacting protein kinase 33 OS=Oryza sativa ... [more]
CIPK3_ARATH2.869e-8560.78CBL-interacting serine/threonine-protein kinase 3 ... [more]
CIPKV_ORYSJ3.747e-8561.33CBL-interacting protein kinase 31 OS=Oryza sativa ... [more]
CIPKQ_ARATH3.747e-8559.92CBL-interacting serine/threonine-protein kinase 26... [more]
CIPK3_ORYSJ2.434e-7656.86CBL-interacting protein kinase 3 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900345 VSS Citrus sinensis cDNA clone VS28902 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900345 ID=DC900345|Name=DC900345|organism=Citrus sinensis|type=EST|length=1136bp
ATTAATAATAAAGGCTACGATGGAGCTAAGGCAGATCTCTGGTCTTGCGG
TGTGATTCTTTATGTCTTAATGGCTGGTTACTTGCCTTTTGAAGAATCCA
ATCTGATGGCTTTATATAAGAAGATATTTAAGGCTGACTTCAAGAGTCCT
CCATGGTTCTCGACAAGTGCAAAGAAACTGATCTCAAGAATTTTGGACCC
TAATCCTGTGACACGAATAACGATGGCTGAGGTTATTGAGAATGAGTGGT
TTAAGAAGGGATATAAGCCACCTAGTTTTGAACAACCTAATATTGATCTT
GATGATGTGGATTCTATCTTTAATGAATCGATGGATTCTCGAAACCTTGT
TGTGGAGAGGCGAGAAGAAGGCCCTGTTGCACCTCTCACTATGAATGCGT
TTGAGTTGATCTCCACATCTCAGGGACTCAACCTCAGTTCCCTTTTCGAA
AAGCAAATGGGACTTGTGAAACGAGAAACAAGATTTACATCCAAACGTCC
TGTTAACGAAATTATATCGAAAATTGAGGAAGCTGCATCGCCTTTGGGTT
TTGATGTGAAGAAAAATAATTTCAAGTTGAAGCTTCAAGGGGAAAAAACT
GGACGCAAGGGTCATTTATCTGTTGCAACAGAGATTTTTGAGGTGGCCCC
TTCACTTTACATGGTTGAGCTTCGAAAATCTGGAGGAGATACCTTAGAAT
TTCACAAGTTTTACAAAAACCTTTCGACTGGGCTGAAAGATGTTGTTTGG
AAATCAGGAGATGAAACAATTGTTGAAGGATCTGCAGTCGCTGGTGGCGC
AGGGTCTCAATAGCGGATTTCCTTTCATGACTTGCACTGCTGAATATCTC
CAGCAAATTATATATTGCTTTTGCACCATTGTATCTCAGCTTTGTATTTT
ATCCTCTAGGCCATGTGTTTCCTTCATTTGTGATTCAGAACTCACTTCTC
GTGTACCTTGGTTTGGCTTTTGTGTGGTTTCAGACTTCCAGATGTATCAT
CTCAACGGATATTGAACATAGTCAATTACCTGCAAATTATCAAAAAGAGT
CTCAGTCCACTGTCGTTTTCATTTTGTTTGTTTTTAGTGACTTGTCTATG
GACCAGAAAATTCAATAAAAAGAATATATTGTAAAA
back to top