DC900306

Overview
NameDC900306
Unique NameDC900306
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length283
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1869 contig Csv1_Contig1869:295..576. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900306 vs. ExPASy Swiss-Prot
Match: SNAK2_SOLTU (Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.644e-16
Identity = 31/41 (75.61%), Postives = 36/41 (87.80%), Query Frame = 1
Query:    1 HRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 123
            +RACGTCCARC CVPPGTSG+ E CPCYA++TTH  +RKCP
Sbjct:   64 NRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP 104          
BLAST of DC900306 vs. ExPASy Swiss-Prot
Match: GASA1_ARATH (Gibberellin-regulated protein 1 OS=Arabidopsis thaliana GN=GASA1 PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 8.451e-15
Identity = 30/41 (73.17%), Postives = 34/41 (82.93%), Query Frame = 1
Query:    1 HRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 123
            HRACGTCC RC CVPPGT G+ + C CYA++TTH GRRKCP
Sbjct:   58 HRACGTCCYRCNCVPPGTYGNYDKCQCYASLTTHGGRRKCP 98          
BLAST of DC900306 vs. ExPASy Swiss-Prot
Match: GASA2_ARATH (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana GN=GASA2 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.155e-14
Identity = 28/40 (70.00%), Postives = 34/40 (85.00%), Query Frame = 1
Query:    4 RACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 123
            RAC +CC+RC CVPPGTSG+  +CPCYA++TTH GR KCP
Sbjct:   60 RACNSCCSRCNCVPPGTSGNTHLCPCYASITTHGGRLKCP 99          
BLAST of DC900306 vs. ExPASy Swiss-Prot
Match: GASA3_ARATH (Gibberellin-regulated protein 3 OS=Arabidopsis thaliana GN=GASA3 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.127e-12
Identity = 26/40 (65.00%), Postives = 32/40 (80.00%), Query Frame = 1
Query:    4 RACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 123
            RAC +CC RC CVPPGT+G+  +CPCYA++TT  GR KCP
Sbjct:   60 RACNSCCYRCNCVPPGTAGNHHLCPCYASITTRGGRLKCP 99          
The following BLAST results are available for this feature:
BLAST of DC900306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
SNAK2_SOLTU7.644e-1675.61Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1[more]
GASA1_ARATH8.451e-1573.17Gibberellin-regulated protein 1 OS=Arabidopsis tha... [more]
GASA2_ARATH7.155e-1470.00Gibberellin-regulated protein 2 OS=Arabidopsis tha... [more]
GASA3_ARATH5.127e-1265.00Gibberellin-regulated protein 3 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900306 VSS Citrus sinensis cDNA clone VS28655 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900306 ID=DC900306|Name=DC900306|organism=Citrus sinensis|type=EST|length=283bp
CACAGGGCATGTGGAACCTGCTGTGCCCGTTGCAAGTGTGTTCCTCCGGG
CACTTCAGGCCATCTTGAAGTCTGCCCTTGCTACGCCACCATGACCACCC
ACCATGGCAGACGCAAGTGCCCTTAAAAACAATGATTGTGCATGATACAT
GATACATGCACCTGTCCGTCGCTGCTTGTGGCAACTGGCTAGTGATACAT
CTATTTATATATCGTCAAATTAAATAAAGCGATGTTAATTGCTCATTTCT
GTGAGTAAATTAATTAAATTAATGTTTGTTCGT
back to top