DC900295

Overview
NameDC900295
Unique NameDC900295
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length717
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1923 contig Csv1_Contig1923:144..860. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900295 vs. ExPASy Swiss-Prot
Match: EXPA4_ARATH (Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 4.311e-127
Identity = 205/232 (88.36%), Postives = 221/232 (95.26%), Query Frame = 3
Query:    3 YSGGPWQSAHATFYGGSDASGTMEGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNFRV 698
            YSGG WQ+AHATFYGGSDASGTM GACGYGNLYSQGYG NTAALSTALFNNG+SCGACFE+KCAN+P WCHSGSPSIL+TATNFCPPN A PSDNGGWCNPPR HFDLAMP+FLKIA+YRAGIVPVSYRRVPCRK+GGIRFTING RYFNLVL+TNVAGAGDI+R +VKGSRTGWMS+SRNWGQNWQSNAVLVGQ+LSFRV  SDRR+STSWN+VP+NWQFGQTFVGKNFRV
Sbjct:   26 YSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGDIVRASVKGSRTGWMSLSRNWGQNWQSNAVLVGQALSFRVTGSDRRTSTSWNMVPSNWQFGQTFVGKNFRV 257          
BLAST of DC900295 vs. ExPASy Swiss-Prot
Match: EXPA6_ARATH (Expansin-A6 OS=Arabidopsis thaliana GN=EXPA6 PE=2 SV=2)

HSP 1 Score: 449.514 bits (1155), Expect = 8.130e-126
Identity = 202/232 (87.07%), Postives = 221/232 (95.26%), Query Frame = 3
Query:    3 YSGGPWQSAHATFYGGSDASGTMEGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNFRV 698
            Y+GG W++AHATFYGGSDASGTM GACGYGNLYSQGYGVNTAALSTALFNNG SCGACFE+KCA++P WCHSGSPSI +TATNFCPPN+A PSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVS+RRVPCRK+GGIRFTINGFRYFNLVLVTNVAGAG+I+R+ VKG+ T WM+MSRNWGQNWQSN+VLVGQSLSFRV +SDRRSSTSWNI PANW+FGQTF+GKNFRV
Sbjct:   26 YNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGNIVRLGVKGTHTSWMTMSRNWGQNWQSNSVLVGQSLSFRVTSSDRRSSTSWNIAPANWKFGQTFMGKNFRV 257          
BLAST of DC900295 vs. ExPASy Swiss-Prot
Match: EXPA7_ORYSJ (Expansin-A7 OS=Oryza sativa subsp. japonica GN=EXPA7 PE=2 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 2.214e-123
Identity = 202/234 (86.32%), Postives = 213/234 (91.03%), Query Frame = 3
Query:    3 YSGGPWQSAHATFYGGSDASGTMEGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAW--CHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNFRV 698
            Y GG WQSAHATFYGGSDASGTM GACGYGNLYSQGYGVN AALSTALFN+G SCGACFEIKC N+P W  CH GSPSIL+TATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFL IAEYRAGIVPVSYRRVPCRKKGG+RFTINGFRYFNLVL+TNVAGAGDI+R +VKG+ TGWM MSRNWGQNWQSN+VLVGQ+LSFRV  SDRR+STSWN  PA W FGQTF GKNFRV
Sbjct:   31 YGGGEWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNSGQSCGACFEIKCVNQPGWEWCHPGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLHIAEYRAGIVPVSYRRVPCRKKGGVRFTINGFRYFNLVLITNVAGAGDIVRASVKGTSTGWMPMSRNWGQNWQSNSVLVGQALSFRVTGSDRRTSTSWNAAPAGWHFGQTFEGKNFRV 264          
BLAST of DC900295 vs. ExPASy Swiss-Prot
Match: EXPA3_ARATH (Expansin-A3 OS=Arabidopsis thaliana GN=EXPA3 PE=2 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 5.454e-122
Identity = 201/232 (86.64%), Postives = 213/232 (91.81%), Query Frame = 3
Query:    3 YSGGPWQSAHATFYGGSDASGTMEGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNFRV 698
            YSGGPWQ+AHATFYGGSDASGTM GACGYGNLYSQGYGVNTAALSTALFNNG SCGACFEIKC ++P WC  G+PSILVTATNFCPPN+A PSD+GGWCNPPR HFDLAMPMFLKI  YRAGIVPVSYRRVPCRK GGIRFT+NGFRYFNLVLVTNVAGAGDI  V+VKGS+T W+ MSRNWGQNWQSNAVL+GQSLSFRV ASDRRSSTSWN+ PA WQFGQTF GKNFRV
Sbjct:   31 YSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGSKTDWVRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPATWQFGQTFSGKNFRV 262          
BLAST of DC900295 vs. ExPASy Swiss-Prot
Match: EXP16_ARATH (Expansin-A16 OS=Arabidopsis thaliana GN=EXPA16 PE=2 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 9.302e-122
Identity = 196/232 (84.48%), Postives = 214/232 (92.24%), Query Frame = 3
Query:    3 YSGGPWQSAHATFYGGSDASGTMEGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNFRV 698
            +SGG WQ+AHATFYGG+DASGTM GACGYGNLYSQGYG NTAALST+LFN+G SCGACFEIKC N+P WCH G+PS+ VTATNFCPPN A PSDNGGWCNPPR HFDLAMP+FLKIAEYRAGIVP+SYRRV CRK GGIRFTING RYFNLVL+TNVAGAGDI R +VKGS+TGWMS++RNWGQNWQSNAVLVGQSLSFRV +SDRR+STSWNI P+NWQFGQTFVGKNFRV
Sbjct:   29 FSGGSWQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALSTSLFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSHFDLAMPVFLKIAEYRAGIVPISYRRVACRKSGGIRFTINGHRYFNLVLITNVAGAGDIARTSVKGSKTGWMSLTRNWGQNWQSNAVLVGQSLSFRVTSSDRRTSTSWNIAPSNWQFGQTFVGKNFRV 260          
BLAST of DC900295 vs. ExPASy Swiss-Prot
Match: EXPA9_ARATH (Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 SV=1)

HSP 1 Score: 421.394 bits (1082), Expect = 2.371e-117
Identity = 190/232 (81.90%), Postives = 212/232 (91.38%), Query Frame = 3
Query:    3 YSGGPWQSAHATFYGGSDASGTMEGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNFRV 698
            Y+GGPW +AHATFYG +DASGTM GACGYGNLYSQGYGVNTAALSTALFNNGLSCG+CFE+KC N+P WC  G+PSIL+TATNFCPPN+   SDNGGWCNPPR HFDLAMPMFL IA+Y+AGIVPVSYRR+PCRKKGGIRFTINGF+YFNLVLVTNVAGAGD+++V+VKGS T W+ +SRNWGQNWQSNA+LVGQSLSFRVK SD RSSTS NI P+NWQFGQT+ GKNFRV
Sbjct:   27 YTGGPWINAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFNQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKYFNLVLVTNVAGAGDVIKVSVKGSNTQWLDLSRNWGQNWQSNALLVGQSLSFRVKTSDGRSSTSNNIAPSNWQFGQTYSGKNFRV 258          
BLAST of DC900295 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSJ (Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 2.634e-100
Identity = 170/227 (74.89%), Postives = 189/227 (83.26%), Query Frame = 3
Query:   12 GPWQSAHATFYGGSDASGTMEGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNF 692
            G WQSAHATFYGG DASGTM GACGYGNLYSQGYG NTAALSTALFN+G +CG+C+E++C N  + C  GS  I VTATNFCPPNY LPSD+GGWCNPPRPHFD+A P FL IA+YRAGIVPVS+RRVPC KKGG+RFT+NG  YFNLVLVTNVAGAGD+  V++KGSRTGW  MSRNWGQNWQSNA L GQSLSF+V ASD R+ TS N+    WQFGQTF G  F
Sbjct:   22 GGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSCYELRCDNAGSSCLPGS--ITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQF 246          
BLAST of DC900295 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSI (Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 2.634e-100
Identity = 170/227 (74.89%), Postives = 189/227 (83.26%), Query Frame = 3
Query:   12 GPWQSAHATFYGGSDASGTMEGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNF 692
            G WQSAHATFYGG DASGTM GACGYGNLYSQGYG NTAALSTALFN+G +CG+C+E++C N  + C  GS  I VTATNFCPPNY LPSD+GGWCNPPRPHFD+A P FL IA+YRAGIVPVS+RRVPC KKGG+RFT+NG  YFNLVLVTNVAGAGD+  V++KGSRTGW  MSRNWGQNWQSNA L GQSLSF+V ASD R+ TS N+    WQFGQTF G  F
Sbjct:   22 GGWQSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNDGAACGSCYELRCDNAGSSCLPGS--ITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQNWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQF 246          
BLAST of DC900295 vs. ExPASy Swiss-Prot
Match: EXPA2_ORYSJ (Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 364.77 bits (935), Expect = 2.634e-100
Identity = 168/227 (74.01%), Postives = 187/227 (82.38%), Query Frame = 3
Query:   12 GPWQSAHATFYGGSDASGTMEGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNF 692
            G WQSAHATFYGG DASGTM GACGYGNLYS GYG NTAALST LFN+G +CG+C+E++C N+  WC  GS  + VTATN CPPNYALP+D+GGWCNPPRPHFD+A P FL+I  YRAGIVPVSYRRVPC KKGGIRFTING  YFNLVLVTNVAG GD+  V++KGS TGW  MSRNWGQNWQSN+ L GQSLSF+V  SD R+ TS N+VPA WQFGQTF G  F
Sbjct:   27 GSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTVLFNDGAACGSCYELRCDNDGQWCLPGS--VTVTATNLCPPNYALPNDDGGWCNPPRPHFDMAEPAFLQIGVYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSTGWQPMSRNWGQNWQSNSYLDGQSLSFQVAVSDGRTVTSNNVVPAGWQFGQTFEGGQF 251          
BLAST of DC900295 vs. ExPASy Swiss-Prot
Match: EXP15_ARATH (Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=2 SV=2)

HSP 1 Score: 362.459 bits (929), Expect = 1.307e-99
Identity = 170/231 (73.59%), Postives = 192/231 (83.12%), Query Frame = 3
Query:    3 YSGGPWQSAHATFYGGSDASGTMEGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAGAGDILRVNVKGSRTGWMSMSRNWGQNWQSNAVLVGQSLSFRVKASDRRSSTSWNIVPANWQFGQTFVGKNFR 695
            Y  G W +AHATFYGGSDASGTM GACGYGNLYSQGYG NTAALSTALFNNGLSCGACFEIKC ++ AWC  G+  I+VTATNFCPPN ALP++ GGWCNPP  HFDL+ P+F +IA+Y+AG+VPVSYRRVPC ++GGIRFTING  YFNLVLVTNV GAGD+  V VKGSRT W  MSRNWGQNWQSN +L GQ+LSF+V ASD R+  S NI PA+W FGQTF G+ FR
Sbjct:   26 YDAG-WVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIKCQSDGAWCLPGA--IIVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGDVHSVAVKGSRTRWQQMSRNWGQNWQSNNLLNGQALSFKVTASDGRTVVSNNIAPASWSFGQTFTGRQFR 253          
The following BLAST results are available for this feature:
BLAST of DC900295 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 95
Match NameE-valueIdentityDescription
EXPA4_ARATH4.311e-12788.36Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 ... [more]
EXPA6_ARATH8.130e-12687.07Expansin-A6 OS=Arabidopsis thaliana GN=EXPA6 PE=2 ... [more]
EXPA7_ORYSJ2.214e-12386.32Expansin-A7 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA3_ARATH5.454e-12286.64Expansin-A3 OS=Arabidopsis thaliana GN=EXPA3 PE=2 ... [more]
EXP16_ARATH9.302e-12284.48Expansin-A16 OS=Arabidopsis thaliana GN=EXPA16 PE=... [more]
EXPA9_ARATH2.371e-11781.90Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 ... [more]
EXPA4_ORYSJ2.634e-10074.89Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA4_ORYSI2.634e-10074.89Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4... [more]
EXPA2_ORYSJ2.634e-10074.01Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXP15_ARATH1.307e-9973.59Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900295 VSS Citrus sinensis cDNA clone VS28642 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900295 ID=DC900295|Name=DC900295|organism=Citrus sinensis|type=EST|length=717bp
ATTACTCCGGTGGCCCATGGCAAAGCGCCCATGCCACCTTTTACGGCGGC
TCTGACGCCTCCGGCACCATGGAAGGAGCGTGCGGTTACGGTAACTTGTA
CAGCCAGGGCTACGGCGTGAATACGGCGGCGCTGAGCACGGCGCTGTTCA
ACAATGGCTTGAGCTGCGGTGCTTGCTTTGAGATCAAGTGTGCAAACGAA
CCCGCGTGGTGTCACTCCGGGAGCCCTTCCATTTTGGTTACCGCTACAAA
CTTTTGCCCGCCCAATTACGCACTCCCAAGTGACAATGGCGGCTGGTGTA
ACCCTCCTCGCCCTCATTTTGACCTCGCCATGCCCATGTTCCTCAAGATT
GCTGAGTACCGCGCCGGCATCGTCCCCGTCTCCTACCGCCGGGTACCATG
CCGCAAGAAGGGAGGAATCAGGTTCACAATAAACGGGTTCCGCTACTTCA
ACTTGGTTCTGGTCACCAACGTGGCGGGTGCAGGGGATATCCTGAGGGTG
AACGTGAAAGGGTCAAGAACTGGCTGGATGAGCATGAGCCGTAACTGGGG
CCAAAACTGGCAGTCTAACGCAGTGCTGGTAGGGCAGTCACTTTCGTTTA
GGGTGAAAGCCAGTGACCGACGCAGCTCCACCTCGTGGAACATTGTGCCA
GCTAACTGGCAGTTTGGTCAAACATTCGTTGGAAAGAATTTCAGAGTCTA
AGTTAACGGAGGAGTTT
back to top