DC900252

Overview
NameDC900252
Unique NameDC900252
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length815
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6307 contig Csv1_Contig6307:160..974. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900252 vs. ExPASy Swiss-Prot
Match: ADF1_PETHY (Actin-depolymerizing factor 1 OS=Petunia hybrida GN=ADF1 PE=2 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.819e-67
Identity = 123/139 (88.49%), Postives = 133/139 (95.68%), Query Frame = 1
Query:   46 MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLPAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPSEMGLDVFKDRAN 462
            MANAASGMAVHDDCKL+FLELKAKRT+RFIV+KIEEKQKQV+VEK+GEPT++YEDFAASLP  ECRYAVYD+DFVTAENCQKSRIFFIAW PDTARVRSKMIYASSKDRFKRELDGIQVELQA DP+EMGLDV + RAN
Sbjct:    1 MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKIGEPTESYEDFAASLPENECRYAVYDFDFVTAENCQKSRIFFIAWCPDTARVRSKMIYASSKDRFKRELDGIQVELQACDPTEMGLDVIQSRAN 139          
BLAST of DC900252 vs. ExPASy Swiss-Prot
Match: ADF2_PETHY (Actin-depolymerizing factor 2 OS=Petunia hybrida GN=ADF2 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 4.809e-67
Identity = 123/142 (86.62%), Postives = 135/142 (95.07%), Query Frame = 1
Query:   46 MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLPAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPSEMGLDVFKDRAN*IK 471
            MANAASGMAVHDDCKLKFLELKAKRTYRFI++KIEEKQK+V+VEKLGEPT++YEDF A LPA+ECRYAVYD+DF+T EN QKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDP+EMGLDVF+ RA  I+
Sbjct:    1 MANAASGMAVHDDCKLKFLELKAKRTYRFIIYKIEEKQKEVVVEKLGEPTESYEDFTAGLPADECRYAVYDFDFMTKENHQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPTEMGLDVFRSRAGGIE 142          
BLAST of DC900252 vs. ExPASy Swiss-Prot
Match: ADF4_ARATH (Actin-depolymerizing factor 4 OS=Arabidopsis thaliana GN=ADF4 PE=2 SV=2)

HSP 1 Score: 250.751 bits (639), Expect = 6.944e-66
Identity = 121/139 (87.05%), Postives = 131/139 (94.24%), Query Frame = 1
Query:   46 MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLPAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPSEMGLDVFKDRAN 462
            MANAASGMAVHDDCKL+FLELKAKRT+RFIV+KIEEKQKQVIVEK+GEP  TYEDFAASLPA+ECRYA+YD+DFVTAENCQKS+IFFIAW PD A+VRSKMIYASSKDRFKRELDGIQVELQATDP+EM LDV K R N
Sbjct:    1 MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVLKSRVN 139          
BLAST of DC900252 vs. ExPASy Swiss-Prot
Match: ADF1_ARATH (Actin-depolymerizing factor 1 OS=Arabidopsis thaliana GN=ADF1 PE=1 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 6.944e-66
Identity = 119/139 (85.61%), Postives = 133/139 (95.68%), Query Frame = 1
Query:   46 MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLPAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPSEMGLDVFKDRAN 462
            MANAASGMAVHDDCKL+FLELKAKRT+RFIV+KIEEKQKQV+VEK+G+P QTYE+FAA LPA+ECRYA+YD+DFVTAENCQKS+IFFIAW PD A+VRSKMIYASSKDRFKRELDGIQVELQATDP+EM LDVF+ RAN
Sbjct:    1 MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEFAACLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVFRSRAN 139          
BLAST of DC900252 vs. ExPASy Swiss-Prot
Match: ADF2_ARATH (Actin-depolymerizing factor 2 OS=Arabidopsis thaliana GN=ADF2 PE=2 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 6.499e-64
Identity = 118/139 (84.89%), Postives = 131/139 (94.24%), Query Frame = 1
Query:   46 MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLPAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPSEMGLDVFKDRAN 462
            MANAASGMAVHDDCKLKF+ELKAKRT+R IV+KIE+KQ  VIVEKLGEP Q+Y+DFAASLPA++CRY +YD+DFVTAENCQKS+IFFIAWSPDTA+VR KMIYASSKDRFKRELDGIQVELQATDP+EMGLDVFK R N
Sbjct:    1 MANAASGMAVHDDCKLKFMELKAKRTFRTIVYKIEDKQ--VIVEKLGEPEQSYDDFAASLPADDCRYCIYDFDFVTAENCQKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVELQATDPTEMGLDVFKSRTN 137          
BLAST of DC900252 vs. ExPASy Swiss-Prot
Match: ADF7_ORYSJ (Actin-depolymerizing factor 7 OS=Oryza sativa subsp. japonica GN=ADF7 PE=3 SV=2)

HSP 1 Score: 243.047 bits (619), Expect = 1.448e-63
Identity = 115/139 (82.73%), Postives = 130/139 (93.53%), Query Frame = 1
Query:   46 MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLPAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPSEMGLDVFKDRAN 462
            MANAASGMAV D+CKLKFLELKAKRTYRFI++KI+EK+K V+VEK+GEP   Y+DFAASLPA ECRYA++DYDFVT ENCQKS+IFFIAWSPDT+RVRSKMIYASSKDRFKRELDGIQVELQATDP+E+GLDV + RAN
Sbjct:    1 MANAASGMAVDDECKLKFLELKAKRTYRFIIYKIDEKKKMVVVEKVGEPVLNYDDFAASLPANECRYAIFDYDFVTEENCQKSKIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPTEVGLDVIRGRAN 139          
BLAST of DC900252 vs. ExPASy Swiss-Prot
Match: ADF3_ARATH (Actin-depolymerizing factor 3 OS=Arabidopsis thaliana GN=ADF3 PE=1 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 7.186e-63
Identity = 115/139 (82.73%), Postives = 130/139 (93.53%), Query Frame = 1
Query:   46 MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLPAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPSEMGLDVFKDRAN 462
            MANAASGMAVHDDCKLKF+ELK KRT+RFI++KIEE QKQVIVEK+GEP QT+ED AASLPA+ECRYA++D+DFV++E   +SRIFF+AWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDP+EM LDVFK RAN
Sbjct:    1 MANAASGMAVHDDCKLKFMELKTKRTHRFIIYKIEELQKQVIVEKIGEPGQTHEDLAASLPADECRYAIFDFDFVSSEGVPRSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVFKSRAN 139          
BLAST of DC900252 vs. ExPASy Swiss-Prot
Match: ADF10_ARATH (Actin-depolymerizing factor 10 OS=Arabidopsis thaliana GN=ADF10 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 8.784e-61
Identity = 110/139 (79.14%), Postives = 124/139 (89.21%), Query Frame = 1
Query:   46 MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLPAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPSEMGLDVFKDRAN 462
            MAN+ASGM V D+CKLKFLELKAKR YRFIVFKI+EK +QV+++KLG P +TYEDF  S+P +ECRYAVYDYDF T ENCQKS+IFFIAWSPDT+RVRSKM+YASSKDRFKRELDGIQVELQATDPSEM LD+ K R N
Sbjct:    1 MANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYEDFTRSIPEDECRYAVYDYDFTTPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVELQATDPSEMSLDIIKGRVN 139          
BLAST of DC900252 vs. ExPASy Swiss-Prot
Match: ADF8_ARATH (Actin-depolymerizing factor 8 OS=Arabidopsis thaliana GN=ADF8 PE=2 SV=2)

HSP 1 Score: 229.18 bits (583), Expect = 2.164e-59
Identity = 106/139 (76.26%), Postives = 126/139 (90.65%), Query Frame = 1
Query:   46 MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLPAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPSEMGLDVFKDRAN 462
            MAN+ASGM V+D+CK+KFLELKAKRTYRFIVFKI+EK +QV +EKLG P +TY+DF +S+P +ECRYAVYD+DF T +NCQKS+IFFIAWSPDT+RVRSKM+YASSKDRFKRE++GIQVELQATDPSEM LD+ K R N
Sbjct:    1 MANSASGMHVNDECKIKFLELKAKRTYRFIVFKIDEKAQQVQIEKLGNPEETYDDFTSSIPDDECRYAVYDFDFTTEDNCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMEGIQVELQATDPSEMSLDIIKGRLN 139          
BLAST of DC900252 vs. ExPASy Swiss-Prot
Match: ADF1_ORYSJ (Actin-depolymerizing factor 1 OS=Oryza sativa subsp. japonica GN=ADF1 PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.402e-58
Identity = 105/138 (76.09%), Postives = 128/138 (92.75%), Query Frame = 1
Query:   46 MANAASGMAVHDDCKLKFLELKAKRTYRFIVFKIEEKQKQVIVEKLGEPTQTYEDFAASLPAEECRYAVYDYDFVTAENCQKSRIFFIAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPSEMGLDVFKDRA 459
            M+N+ASGMAV D+CKLKFLELKAKR++RFIVFKI EK +QV+V++LG+P ++Y+DF A LPA+ECRYAV+D+DFVT ENCQKS+IFFI+W+PDT+RVRSKM+YASSKDRFKRELDGIQVELQATDPSEM +D+ K RA
Sbjct:    1 MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFTACLPADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVELQATDPSEMSMDIVKSRA 138          
The following BLAST results are available for this feature:
BLAST of DC900252 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
ADF1_PETHY2.819e-6788.49Actin-depolymerizing factor 1 OS=Petunia hybrida G... [more]
ADF2_PETHY4.809e-6786.62Actin-depolymerizing factor 2 OS=Petunia hybrida G... [more]
ADF4_ARATH6.944e-6687.05Actin-depolymerizing factor 4 OS=Arabidopsis thali... [more]
ADF1_ARATH6.944e-6685.61Actin-depolymerizing factor 1 OS=Arabidopsis thali... [more]
ADF2_ARATH6.499e-6484.89Actin-depolymerizing factor 2 OS=Arabidopsis thali... [more]
ADF7_ORYSJ1.448e-6382.73Actin-depolymerizing factor 7 OS=Oryza sativa subs... [more]
ADF3_ARATH7.186e-6382.73Actin-depolymerizing factor 3 OS=Arabidopsis thali... [more]
ADF10_ARATH8.784e-6179.14Actin-depolymerizing factor 10 OS=Arabidopsis thal... [more]
ADF8_ARATH2.164e-5976.26Actin-depolymerizing factor 8 OS=Arabidopsis thali... [more]
ADF1_ORYSJ1.402e-5876.09Actin-depolymerizing factor 1 OS=Oryza sativa subs... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900252 VSS Citrus sinensis cDNA clone VS28291 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900252 ID=DC900252|Name=DC900252|organism=Citrus sinensis|type=EST|length=815bp
AAAATTTCTCTGTACTTTGCTTCTTAGATCTTGATCCTAGAAACCATGGC
TAATGCTGCTTCTGGGATGGCTGTACATGATGACTGTAAGCTAAAGTTCT
TGGAGTTGAAAGCCAAGAGAACCTACCGCTTCATAGTATTTAAGATTGAG
GAGAAGCAGAAGCAGGTCATTGTGGAAAAACTTGGTGAGCCAACTCAAAC
CTATGAAGATTTTGCTGCCAGCCTTCCTGCTGAGGAGTGCCGATATGCTG
TGTATGATTATGATTTTGTTACCGCAGAGAACTGCCAAAAAAGCAGGATT
TTCTTCATTGCATGGTCTCCCGACACTGCAAGAGTAAGAAGCAAGATGAT
TTATGCAAGCTCCAAGGACAGGTTCAAGAGAGAGCTAGATGGCATTCAAG
TGGAGCTGCAGGCAACTGATCCATCTGAGATGGGTCTTGACGTATTTAAA
GACCGTGCCAACTAAATAAAGGCTCCTGATCTCAGCAATTGAGATTGTTT
TTATCTTTTGTGCTTTACCTAAAGGTGAAATGTTAATAGTTTGTGGCGGC
AGCTTGAATCTAACTGAATTATGATATTGGTTTGTTGTTCAAGTTTCACC
GATGCAGTATTCTCGTCTAGAACCATTTCAGTGGTCTTTATGATGTCTTT
ATTGATTTGTTGTGGTGTGGAAGTTATGGGATGAGTGGCTACTTATAGCT
ATTTCGTCAAGCTAAGGTGTTTCAATTGATGGGGGATGGATAACCCTCTG
TTAGGGTTGTTTTTACTTTGAAAATGGATGTTTCATTTTGAACTTTATAA
ATGGATGTTTCATTT
back to top