DC900207

Overview
NameDC900207
Unique NameDC900207
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length572
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9707 contig Csv1_Contig9707:113..684. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900207 vs. ExPASy Swiss-Prot
Match: AGL5_ARATH (Agamous-like MADS-box protein AGL5 OS=Arabidopsis thaliana GN=AGL5 PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.524e-59
Identity = 110/129 (85.27%), Postives = 124/129 (96.12%), Query Frame = 3
Query:  180 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREIQNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSR 566
            NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL++FS+RGRLYEYANNSVR TI+RYKKAC+D+ NP +ITEANTQ+YQQEA+KLRRQIR+IQNLNRHILGE+L +LNFKELKNLE+RLEKGI RVRS+
Sbjct:   28 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYANNSVRGTIERYKKACSDAVNPPTITEANTQYYQQEASKLRRQIRDIQNLNRHILGESLGSLNFKELKNLESRLEKGISRVRSK 156          
BLAST of DC900207 vs. ExPASy Swiss-Prot
Match: AGL1_ARATH (Agamous-like MADS-box protein AGL1 OS=Arabidopsis thaliana GN=AGL1 PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.137e-58
Identity = 108/129 (83.72%), Postives = 122/129 (94.57%), Query Frame = 3
Query:  180 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREIQNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSR 566
            NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL++FS+RGRLYEYANNSVR TI+RYKKAC+D+ NP S+TEANTQ+YQQEA+KLRRQIR+IQN NRHI+GE+L +LNFKELKNLE RLEKGI RVRS+
Sbjct:   28 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYANNSVRGTIERYKKACSDAVNPPSVTEANTQYYQQEASKLRRQIRDIQNSNRHIVGESLGSLNFKELKNLEGRLEKGISRVRSK 156          
BLAST of DC900207 vs. ExPASy Swiss-Prot
Match: AG_TOBAC (Floral homeotic protein AGAMOUS OS=Nicotiana tabacum GN=AG1 PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.703e-53
Identity = 100/129 (77.52%), Postives = 119/129 (92.25%), Query Frame = 3
Query:  180 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREIQNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSR 566
            NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSV+ATI+RYKKAC+DSSN GSI+EAN Q+YQQEA+KLR QI  +QN NR++LGE+L+ L+ ++LKNLE ++EKGI ++RS+
Sbjct:   29 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSISEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSK 157          
BLAST of DC900207 vs. ExPASy Swiss-Prot
Match: AG_PETHY (Floral homeotic protein AGAMOUS OS=Petunia hybrida GN=AG1 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 6.021e-53
Identity = 99/129 (76.74%), Postives = 117/129 (90.70%), Query Frame = 3
Query:  180 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREIQNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSR 566
            NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSV+ATI+RYKKAC+DSSN GSI EAN Q+YQQEA+KLR QI  +QN NR+ LGE+L+ LN ++L+NLE ++EKGI ++R++
Sbjct:   29 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKATIERYKKACSDSSNTGSIAEANAQYYQQEASKLRAQIGNLQNQNRNFLGESLAALNLRDLRNLEQKIEKGISKIRAK 157          
BLAST of DC900207 vs. ExPASy Swiss-Prot
Match: AG_SOLLC (Floral homeotic protein AGAMOUS OS=Solanum lycopersicum GN=AG1 PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.027e-52
Identity = 98/129 (75.97%), Postives = 117/129 (90.70%), Query Frame = 3
Query:  180 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREIQNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSR 566
            NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVAL+VFS+RGRLYEYANNSV+ATI+RYKKAC+DSSN GS++EAN Q+YQQEA+KLR QI  + N NR+++GEAL+ +  KELKNLE R+EKGI ++RS+
Sbjct:   29 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSNRGRLYEYANNSVKATIERYKKACSDSSNTGSVSEANAQYYQQEASKLRAQIGNLMNQNRNMMGEALAGMKLKELKNLEQRIEKGISKIRSK 157          
BLAST of DC900207 vs. ExPASy Swiss-Prot
Match: AG_PANGI (Floral homeotic protein AGAMOUS OS=Panax ginseng GN=AG2 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 2.797e-50
Identity = 95/129 (73.64%), Postives = 113/129 (87.60%), Query Frame = 3
Query:  180 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREIQNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSR 566
            NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANNSV+ TI+RYKKAC DS N  S++EAN QFYQQEA+KLR++I  IQ  NR+++GE+L +L  ++LK LE +LEKGI R+RS+
Sbjct:   29 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNSVKGTIERYKKACTDSPNTSSVSEANAQFYQQEASKLRQEISSIQKNNRNMMGESLGSLTVRDLKGLETKLEKGISRIRSK 157          
BLAST of DC900207 vs. ExPASy Swiss-Prot
Match: AG_ARATH (Floral homeotic protein AGAMOUS OS=Arabidopsis thaliana GN=AG PE=1 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 6.889e-49
Identity = 93/129 (72.09%), Postives = 112/129 (86.82%), Query Frame = 3
Query:  180 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREIQNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSR 566
            NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY+NNSV+ TI+RYKKA +D+SN GS+ E N Q+YQQE+ KLR+QI  IQN NR ++GE + +++ KEL+NLE RLE+ I R+RS+
Sbjct:   29 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLERSITRIRSK 157          
BLAST of DC900207 vs. ExPASy Swiss-Prot
Match: AGL11_ARATH (Agamous-like MADS-box protein AGL11 OS=Arabidopsis thaliana GN=AGL11 PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 6.889e-49
Identity = 91/129 (70.54%), Postives = 115/129 (89.15%), Query Frame = 3
Query:  180 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREIQNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSR 566
            N+TNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFS+RGRLYEYANN++R+TI+RYKKAC+DS+N  ++ E N  +YQQE+ KLR+QI+ IQN NR+++G++LS+L+ KELK +E RLEK I R+RS+
Sbjct:   13 NSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNNIRSTIERYKKACSDSTNTSTVQEINAAYYQQESAKLRQQIQTIQNSNRNLMGDSLSSLSVKELKQVENRLEKAISRIRSK 141          
BLAST of DC900207 vs. ExPASy Swiss-Prot
Match: AG_BRANA (Floral homeotic protein AGAMOUS OS=Brassica napus GN=AG1 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.175e-48
Identity = 91/129 (70.54%), Postives = 112/129 (86.82%), Query Frame = 3
Query:  180 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREIQNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSR 566
            NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEY+NNSV+ TI+RYKKA +D+SN GS+ E N Q+YQQE+ KLR+QI  IQN NR ++GE + +++ KEL+NLE RL++ + R+RS+
Sbjct:   29 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSNNSVKGTIERYKKAISDNSNTGSVAEINAQYYQQESAKLRQQIISIQNSNRQLMGETIGSMSPKELRNLEGRLDRSVNRIRSK 157          
BLAST of DC900207 vs. ExPASy Swiss-Prot
Match: MAD58_ORYSJ (MADS-box transcription factor 58 OS=Oryza sativa subsp. japonica GN=MADS58 PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 2.895e-47
Identity = 88/129 (68.22%), Postives = 112/129 (86.82%), Query Frame = 3
Query:  180 NTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVRATIDRYKKACADSSNPGSITEANTQFYQQEATKLRRQIREIQNLNRHILGEALSTLNFKELKNLEARLEKGIGRVRSR 566
            NTTNRQVTFCKRR+GLLKKAYELSVLCDAEVAL+VFSSRGRLYEY+NNSV+ TI+RYKKA +D+SN  ++ E N Q YQQEA KL++QI  +QN NR ++G+ ++T+N +ELK LE RL+KG+G++R+R
Sbjct:   55 NTTNRQVTFCKRRSGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSNNSVKETIERYKKANSDTSNASTVAEINAQHYQQEAAKLKQQITNLQNSNRTLVGDNITTMNHRELKQLEGRLDKGLGKIRAR 183          
The following BLAST results are available for this feature:
BLAST of DC900207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 115
Match NameE-valueIdentityDescription
AGL5_ARATH2.524e-5985.27Agamous-like MADS-box protein AGL5 OS=Arabidopsis ... [more]
AGL1_ARATH2.137e-5883.72Agamous-like MADS-box protein AGL1 OS=Arabidopsis ... [more]
AG_TOBAC2.703e-5377.52Floral homeotic protein AGAMOUS OS=Nicotiana tabac... [more]
AG_PETHY6.021e-5376.74Floral homeotic protein AGAMOUS OS=Petunia hybrida... [more]
AG_SOLLC1.027e-5275.97Floral homeotic protein AGAMOUS OS=Solanum lycoper... [more]
AG_PANGI2.797e-5073.64Floral homeotic protein AGAMOUS OS=Panax ginseng G... [more]
AG_ARATH6.889e-4972.09Floral homeotic protein AGAMOUS OS=Arabidopsis tha... [more]
AGL11_ARATH6.889e-4970.54Agamous-like MADS-box protein AGL11 OS=Arabidopsis... [more]
AG_BRANA1.175e-4870.54Floral homeotic protein AGAMOUS OS=Brassica napus ... [more]
MAD58_ORYSJ2.895e-4768.22MADS-box transcription factor 58 OS=Oryza sativa s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900207 VSS Citrus sinensis cDNA clone VS28244 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900207 ID=DC900207|Name=DC900207|organism=Citrus sinensis|type=EST|length=572bp
AAAAGAAGCGAGCTAGCTCTAGTGAAATTATCAAGAATCCTTATTCCTCT
TTAGGTCTTCTTTCCAGGTGTAGCTCAAGCAAGTTACCAGCAACCATGGA
GTTTCCAAAACAAAACCCAGAAAGCTCAAGCCAAAGCAAGAAAATAGGAA
GAGGCAAAATTGAGATAAAGCGGATCGAGAACACAACAAACAGACAAGTC
ACCTTCTGTAAACGCCGAAATGGATTGTTGAAGAAAGCTTATGAACTGTC
TGTCTTGTGTGATGCTGAAGTTGCTCTCATCGTCTTCTCTAGCCGTGGCC
GCCTTTATGAATATGCTAACAACAGTGTCAGAGCAACAATTGACAGGTAC
AAGAAAGCATGTGCCGATTCTTCTAACCCAGGATCTATTACTGAAGCTAA
CACTCAGTTTTACCAGCAAGAAGCCACAAAACTACGAAGACAAATCCGGG
AGATTCAGAATTTGAACAGGCACATTCTGGGTGAGGCCCTCAGCACTTTA
AACTTTAAGGAGCTCAAGAACCTTGAGGCAAGACTTGAGAAGGGAATCGG
CAGAGTCAGATCCAGAACAAGT
back to top