CX043380

Overview
NameCX043380
Unique NameCX043380
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length796
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1296 contig Csv1_Contig1296:780..1575. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX043380 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.801e-29
Identity = 71/190 (37.37%), Postives = 108/190 (56.84%), Query Frame = -3
Query:  231 ALASNSLLVLGTSSVPEPLLDVHGNKVESTIKYYIVSAIWXXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLSPYNNST-IVRESTDLNLRFSVLLSGRD-YCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGR-SFEDGVRRLVL 791
            A  S S      ++   P+LD  G+++++ ++YY++S+I                 CP  V+Q  SD+ NG  +  S  ++   +VR STD+N+ F  +   RD  C+   +W++DNYD ++GKW++TT G+ G PG  TL +WFK+EK G     YK   CPSVC+SC  LC ++GR S +DG  RL L
Sbjct:   13 AFTSKSYFFGVANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPI---RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVLG--YKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of CX043380 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 3.934e-26
Identity = 70/199 (35.18%), Postives = 103/199 (51.76%), Query Frame = -3
Query:  207 LALASNSLLVLGTSSVPEPLLDVHGNKVESTIKYYIVSAI--WXXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFEDGVRRLVLVRDDEPAF 794
            LA A+N LL     S P P+LD+ G K+ +   YYIV  +                   CP  V+Q   ++ +   L   P N    +VR STDLN+ FS  +  R       +W++D YD ++G++F+T GG+ G+PG ET+ +WFK+E+     G YK+V CP+VC SC   C +VG   +   RR + + D   AF
Sbjct:   18 LAAAANPLLS-AADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCR--WTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAF 212          
BLAST of CX043380 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 7.185e-20
Identity = 64/179 (35.75%), Postives = 92/179 (51.40%), Query Frame = -3
Query:  222 PEPLLDVHGNKVESTIKYYIVSAIWXXXXXXXXXXXXXXGY-CPLDVIQLPSDMQNGIELTLSPYNN--STIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFED-GVRRLVLVRD 746
            P+P++D+ G  V   + Y++VSAIW                 CPL V+Q P D  NG  +  S   N    IV ES DLN++F++ ++    CNE   WKVD +    G W +T GG  G+ G E+  + FK++K G  P  YK   CPS   + +  C+NV   F+   +RRL+L  D
Sbjct:    3 PKPIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFD--NGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN----CNETTAWKVDRFPGVIG-WTVTLGGEKGYHGFESTHSMFKIKKAG-LPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTND 173          
BLAST of CX043380 vs. ExPASy Swiss-Prot
Match: DRTI_DELRE (Kunitz-type serine protease inhibitor DrTI OS=Delonix regia PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.714e-13
Identity = 57/185 (30.81%), Postives = 87/185 (47.03%), Query Frame = -3
Query:  192 EPLLDVHGNKVESTIKYYIVSAIWXXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLS-PYNNSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFEDGVRRLVLVRDDEPAFPVVLI 743
            E + D+ G  V    +YYIVSAI                 CP+ +IQ  SD+Q G+ +  S P  +   +   T+L + F      +  C E   W +      SG+  +  GG + HP  E +  +FK+EK+G+    YK+V CP   +S    C ++G ++E G R LVL   D+  F VV +
Sbjct:    4 EKVYDIEGYPVFLGSEYYIVSAIIGAGGGGVRPGRTRGSMCPMSIIQEQSDLQMGLPVRFSSPEESQGKIYTDTELEIEFVE----KPDCAESSKWVIVK---DSGEARVAIGGSEDHPQGELVRGFFKIEKLGSL--AYKLVFCP---KSSSGSCSDIGINYE-GRRSLVLKSSDDSPFRVVFV 175          
BLAST of CX043380 vs. ExPASy Swiss-Prot
Match: SPORB_IPOBA (Sporamin B OS=Ipomoea batatas GN=GSPO-B1 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.233e-12
Identity = 58/193 (30.05%), Postives = 89/193 (46.11%), Query Frame = -3
Query:  189 TSSVPEPLLDVHGNKVESTIKYYIVSAIW--XXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 758
            T+S   P+LD++G++V +   YYIVSAIW                  C  DVI   SD  NG  +T++P +  +T+V  ST    RF++  +    C     W +  +D+ SG++F+  G            N FK+E + +    YKI    S C+   + C NVGR ++   R   L   + P F  V+ P
Sbjct:   34 TASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNI--ATNKLCVNNVNWGI-KHDSESGQYFVKAGEF-----VSDNSNQFKIEVVNDNLNAYKI----SYCQFGTEKCFNVGRYYDPLTRATRLALSNTP-FVFVIKP 213          
BLAST of CX043380 vs. ExPASy Swiss-Prot
Match: SPOR1_IPOBA (Sporamin A OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.514e-12
Identity = 56/193 (29.02%), Postives = 89/193 (46.11%), Query Frame = -3
Query:  189 SSVPEPLLDVHGNKVESTIKYYIVSAIW-XXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLSPYN---NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 755
            +S   P+LD++G++V +   YY+VSAIW                 C  DVI  P+D+ NG  +T++P      ST+V  ST    RF++  +    C     W +  +D+ASG++F+  G            N FK+E +      YK+ +C    +     C+NVGR  +  +R   L   + P F  V+ P
Sbjct:   37 ASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNI--ATNKLCVNNVNWGI-QHDSASGQYFLKAGEF-----VSDNSNQFKIELVDANLNSYKLTYCQFGSDK----CYNVGRFHDHMLRTTRLALSNSP-FVFVIKP 216          
BLAST of CX043380 vs. ExPASy Swiss-Prot
Match: SPOR2_IPOBA (Sporamin B OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.228e-11
Identity = 57/193 (29.53%), Postives = 89/193 (46.11%), Query Frame = -3
Query:  189 TSSVPEPLLDVHGNKVESTIKYYIVSAIW--XXXXXXXXXXXXXXGYCPLDVIQLPSDMQNGIELTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGIYKIVHCPSVCESCVKLCHNVGRSFEDGVRRLVLVRDDEPAFPVVLIP 758
            T+S   P+LD++G++V +   YY+VSAIW                  C  DVI   SD  NG  +T++P +  +T+V  ST    RF++  +    C     W +  +D+ SG++F+  G            N FK+E + +    YKI    S C+   + C NVGR ++   R   L   + P F  V+ P
Sbjct:   34 TASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNI--ATNKLCVNNVNWGI-KHDSESGQYFVKAGEF-----VSDNSNQFKIEVVNDNLNAYKI----SYCQFGTEKCFNVGRYYDPLTRATRLALSNIP-FVFVIKP 213          
The following BLAST results are available for this feature:
BLAST of CX043380 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
ASP_THECC3.801e-2937.3721 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU3.934e-2635.18Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA7.185e-2035.75Latex serine proteinase inhibitor OS=Carica papaya... [more]
DRTI_DELRE1.714e-1330.81Kunitz-type serine protease inhibitor DrTI OS=Delo... [more]
SPORB_IPOBA3.233e-1230.05Sporamin B OS=Ipomoea batatas GN=GSPO-B1 PE=2 SV=1[more]
SPOR1_IPOBA5.514e-1229.02Sporamin A OS=Ipomoea batatas PE=2 SV=1[more]
SPOR2_IPOBA1.228e-1129.53Sporamin B OS=Ipomoea batatas PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_10F09_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-10F09-L18-1-6.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043380 ID=CX043380; Name=CX043380; organism=Citrus sinensis; type=EST; length=796bp
TTGATTTCGATTTTCATAAGGTATACACCAACAGTAGAATTTATTAACCC
CGAAAGGATCACAGGGTACTTATTCATAATTTTAATCCTAGAGATTAAAG
AGCAGCTAGCCTGGTCCGTTATTTAGAATAATAATACCGCTAGCTGGTTA
GGGTACATTGATTACACAGACGTTGATCTTTCTGTAGCGGGAATTAACAC
AACAGGAAATGCCGGCTCATCATCACGAACCAGAACCAGACGTCGAACGC
CATCCTCAAACGAACGGCCAACGTTGTGGCAGAGTTTGACACAAGACTCG
CAAACGGATGGACAATGAACGATTTTGTATATACCTGGAAAATTTCCAAT
TTTCTCAAGCTTAAACCAATTTAGCAAAGTTTCAGCTCCAGGGTGACCAT
CAAGTCCCCCGGTTGTTATAAACCATTTGCCTGATGCCGCGTCATAATTA
TCAACTTTCCACAACGGTTGTTCGTTACAATAGTCACGTCCAGATAGCAA
CACTGAGAATCTCAAGTTGAGATCAGTGGATTCTCGGACAATTGTAGAAT
TGTTATACGGTGACAGTGTTAATTCGATTCCATTTTGCATATCAGAAGGT
AACTGGATAACGTCCAGCGGACAATATCCGTTTCTGCCACCGTGTAGGCT
AACTCCACCACCGCCAGCTCCCCAGATGGCTGAGACTATGTAGTACTTAA
TGGTGGATTCGACCTTGTTGCCGTGGACATCAAGGAGAGGTTCAGGAACT
GATGAGGTGCCCAAGACCAACAAAGAGTTTGAGGCCAAGGCAAGGA
back to top