DC900198

Overview
NameDC900198
Unique NameDC900198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length634
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9370 contig Csv1_Contig9370:280..915. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900198 vs. ExPASy Swiss-Prot
Match: LAML_ARATH (Lamin-like protein OS=Arabidopsis thaliana GN=At5g15350 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.359e-22
Identity = 45/111 (40.54%), Postives = 70/111 (63.06%), Query Frame = 2
Query:    5 HIVGANKGWNPSINYTLWANNQTFYVNDLISFRYQKTQYNVFMVNQSGYDNCTTEGALGNWS--SGKDFILLDKAKRYYFICGNGQCFNGMKVSVLVHPLHSPPSAAIAAN 331
            + VG NK WNP+INYT+WA  + FY+ D + F + + Q+N+  VN++ Y+ C  +  + NW+  +G+D + L++ K YY + G G C+ GMK+SV V  L  PP +A   N
Sbjct:   29 YTVGENKFWNPNINYTIWAQGKHFYLGDWLYFVFDRNQHNILEVNKTDYEGCIADHPIRNWTRGAGRDIVTLNQTKHYYLLDGKGGCYGGMKLSVKVEKLPPPPKSAPVKN 139          
BLAST of DC900198 vs. ExPASy Swiss-Prot
Match: BCP_PEA (Blue copper protein OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.275e-12
Identity = 44/119 (36.97%), Postives = 65/119 (54.62%), Query Frame = 2
Query:    5 HIVGANKGWNPSINYTLWANNQTFYVNDLISFRYQKTQYNVFMVNQSGYDNCTTEGALGNWSSGKDFILLDKAKRYYFICG-NGQCFNGMKVSVLVHPLHSPPSAAIAANDTSSKSSAP 358
            + VG   GW    +Y+ WA+++TF V D + F Y    + V  V +S Y +CT+  ++   S+G   I L KA ++YFICG  G    GMK+S+ V    S  SAA +A  +SS   +P
Sbjct:   27 YTVGDTSGWVIGGDYSTWASDKTFAVGDSLVFNYGAGAHTVDEVKESDYKSCTSGNSISTDSTGATTIPLKKAGKHYFICGVPGHSTGGMKLSIKV-KASSGSSAAPSATPSSSGKGSP 144          
BLAST of DC900198 vs. ExPASy Swiss-Prot
Match: ENL1_ARATH (Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 2.841e-12
Identity = 43/128 (33.59%), Postives = 68/128 (53.12%), Query Frame = 2
Query:   38 SINYTLWANNQTFYVNDLISFRYQKTQYNVFMVNQSGYDNCTTEGALGNWSSGKDFILLDKAKRYYFICG-NGQCFNGMKVSVLV----HPLHSPPSAAIAANDTSSKSSAPPPVLHTGLVSLRALFV 406
            S ++T WA    F V D I FRY+  + +V  V +  Y++C T   L N++ G+  + LD++  +YFI G NG C  G K+S++V    H + SP  + +   D    + AP P+  +G V L   +V
Sbjct:   47 SYSFTEWAQKARFKVGDFIVFRYESGKDSVLEVTKEAYNSCNTTNPLANYTDGETKVKLDRSGPFYFISGANGHCEKGQKLSLVVISPRHSVISPAPSPVEFED--GPALAPAPI--SGSVRLGGCYV 170          
BLAST of DC900198 vs. ExPASy Swiss-Prot
Match: MAVI_CUCPE (Mavicyanin OS=Cucurbita pepo PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.841e-11
Identity = 34/100 (34.00%), Postives = 53/100 (53.00%), Query Frame = 2
Query:    5 HIVGANKGWNPSI--NYTLWANNQTFYVNDLISFRYQKTQYNVFMVNQSGYDNCTTEGALGNWSSGKDFILLDKAKRYYFICG-NGQCFNGMKVSVLVHP 295
            H VG + GW   +  +Y  WA++  F+V D + F Y    +NV  V+Q  + +C +     +++SG D I L +   +YF+CG  G C  G KV + V P
Sbjct:    4 HKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVDP 103          
BLAST of DC900198 vs. ExPASy Swiss-Prot
Match: ENL2_ARATH (Early nodulin-like protein 2 OS=Arabidopsis thaliana GN=At4g27520 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.841e-11
Identity = 43/124 (34.68%), Postives = 60/124 (48.39%), Query Frame = 2
Query:   11 VGANKGW--NPSINYTLWANNQTFYVNDLISFRYQKTQYNVFMVNQSGYDNCTTEGALGNWSSGKDFILLDKAKRYYFICGN-GQCFNGMKVSVLVHPLHSPPSAA---IAANDTSSKSSAPPP 364
            VG +  W  NP  NY  W+    F V+D + F Y K   +V  VN++ YD C T+  +     G   I LD+   +YFI GN   C  G K++V+V     P +A     AA  +S+  S  PP
Sbjct:   33 VGGSGAWVTNPPENYESWSGKNRFLVHDTLYFSYAKGADSVLEVNKADYDACNTKNPIKRVDDGDSEISLDRYGPFYFISGNEDNCKKGQKLNVVVISARIPSTAQSPHAAAPGSSTPGSMTPP 156          
BLAST of DC900198 vs. ExPASy Swiss-Prot
Match: BABL_CUCSA (Basic blue protein OS=Cucumis sativus PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 9.139e-11
Identity = 31/93 (33.33%), Postives = 49/93 (52.69%), Query Frame = 2
Query:    5 HIVGANKGWNPSINYTLWANNQTFYVNDLISFRYQKTQYNVFMVNQSGYDNCTTEGALGNWSSGKDFILLDKAKRYYFICGNGQCFNGMKVSV 283
            ++VG + GW  + N   W   + F   D++ F Y    +NV +VNQ G+  C T      ++SG+D I L K + Y+     G C +GMK++V
Sbjct:    3 YVVGGSGGW--TFNTESWPKGKRFRAGDILLFNYNPXMHNVVVVNQGGFSTCNTPAGAKVYTSGRDQIKLPKGQSYFICNFPGHCQSGMKIAV 93          
The following BLAST results are available for this feature:
BLAST of DC900198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
LAML_ARATH1.359e-2240.54Lamin-like protein OS=Arabidopsis thaliana GN=At5g... [more]
BCP_PEA1.275e-1236.97Blue copper protein OS=Pisum sativum PE=2 SV=1[more]
ENL1_ARATH2.841e-1233.59Early nodulin-like protein 1 OS=Arabidopsis thalia... [more]
MAVI_CUCPE1.841e-1134.00Mavicyanin OS=Cucurbita pepo PE=1 SV=1[more]
ENL2_ARATH1.841e-1134.68Early nodulin-like protein 2 OS=Arabidopsis thalia... [more]
BABL_CUCSA9.139e-1133.33Basic blue protein OS=Cucumis sativus PE=1 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionDC900198 VSS Citrus sinensis cDNA clone VS28235 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900198 ID=DC900198|Name=DC900198|organism=Citrus sinensis|type=EST|length=634bp
TGACCACATTGTTGGTGCCAACAAAGGCTGGAACCCTAGCATCAACTACA
CTCTCTGGGCCAACAACCAAACCTTCTATGTCAATGACCTCATCTCATTT
AGGTACCAAAAGACACAATACAATGTGTTTATGGTGAACCAAAGTGGTTA
TGACAACTGCACCACAGAAGGGGCATTGGGCAATTGGAGCAGTGGCAAAG
ATTTCATACTTCTGGACAAGGCCAAGAGATACTACTTCATTTGTGGCAAC
GGTCAGTGCTTCAATGGCATGAAAGTATCTGTTCTTGTCCATCCTCTGCA
TTCACCACCCTCAGCTGCCATTGCGGCCAACGATACGTCATCAAAATCTT
CAGCTCCTCCACCGGTGTTGCATACGGGTTTGGTGAGTTTACGAGCTTTA
TTTGTGGCTACTTCCAATTTGGCTAGGAATGGGATGGATCTAGAATGTTA
TAGTTTCAGTTTTTAAGCCCTGTGAACAGCTGTGAGTGTATTATTGTCAT
TGTTTGTTAATGATTTTATTTGGCTTAATGCGGCTTTATTCAACCTTATC
AGCAACTTTCCCTTGGGCATTGTCAAGTGTAAGAATGTATCCAATCCCAG
CTAGTTCTTAAGTCTGTGTGTGCTTTTCTTGGGT
back to top