DC900187

Overview
NameDC900187
Unique NameDC900187
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length749
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3326 contig Csv1_Contig3326:125..873. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900187 vs. ExPASy Swiss-Prot
Match: RPB7_SOYBN (DNA-directed RNA polymerase II subunit RPB7 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 5.622e-80
Identity = 143/151 (94.70%), Postives = 149/151 (98.68%), Query Frame = 1
Query:    1 IISKLMKDVEGTCSGRHGFVVAITSVENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVSMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQSGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVINDPTTI 453
            ++SKLMKDVEGTCSGRHGFVVA+T +ENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVV+MVNKMGFFAEAGPVQIFVSNHLIPDDMEFQSGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVINDP T+
Sbjct:   26 LVSKLMKDVEGTCSGRHGFVVAVTGIENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVTMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQSGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVINDPATV 176          
BLAST of DC900187 vs. ExPASy Swiss-Prot
Match: RPB7_ARATH (DNA-directed RNA polymerase II subunit RPB7 OS=Arabidopsis thaliana GN=RPB19 PE=1 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 7.112e-75
Identity = 134/148 (90.54%), Postives = 143/148 (96.62%), Query Frame = 1
Query:    1 IISKLMKDVEGTCSGRHGFVVAITSVENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVSMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQSGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVINDP 444
            ++SKLMKDVEGTCSGRHGFVVAIT ++ IGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVV++VNKMGFFAEAGPVQIFVS HLIPDDMEFQ+GDMPNYTTSDGSVKIQK+ EVRLKIIGTRVDAT IFC+GTIKDDFLGVINDP
Sbjct:   26 LVSKLMKDVEGTCSGRHGFVVAITGIDTIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVTLVNKMGFFAEAGPVQIFVSKHLIPDDMEFQAGDMPNYTTSDGSVKIQKECEVRLKIIGTRVDATAIFCVGTIKDDFLGVINDP 173          
BLAST of DC900187 vs. ExPASy Swiss-Prot
Match: RPB7_RAT (DNA-directed RNA polymerase II subunit RPB7 OS=Rattus norvegicus GN=Polr2g PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.971e-44
Identity = 78/144 (54.17%), Postives = 113/144 (78.47%), Query Frame = 1
Query:   10 KLMKDVEGTCSGRHGFVVAITSVENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVSMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQ-SGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVIN 438
            KL  +VEGTC+G++GFV+A+T+++NIG G+I+ G GFV +PVKY+ +VFRPFKGE+++AVV+ VNK+G F E GP+  F+S H IP +MEF  + + P Y T D  + IQ+D E+RLKI+GTRVD  +IF IG++ DD+LG+++
Sbjct:   29 KLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS 172          
BLAST of DC900187 vs. ExPASy Swiss-Prot
Match: RPB7_MOUSE (DNA-directed RNA polymerase II subunit RPB7 OS=Mus musculus GN=Polr2g PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.971e-44
Identity = 78/144 (54.17%), Postives = 113/144 (78.47%), Query Frame = 1
Query:   10 KLMKDVEGTCSGRHGFVVAITSVENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVSMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQ-SGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVIN 438
            KL  +VEGTC+G++GFV+A+T+++NIG G+I+ G GFV +PVKY+ +VFRPFKGE+++AVV+ VNK+G F E GP+  F+S H IP +MEF  + + P Y T D  + IQ+D E+RLKI+GTRVD  +IF IG++ DD+LG+++
Sbjct:   29 KLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS 172          
BLAST of DC900187 vs. ExPASy Swiss-Prot
Match: RPB7_HUMAN (DNA-directed RNA polymerase II subunit RPB7 OS=Homo sapiens GN=POLR2G PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.971e-44
Identity = 78/144 (54.17%), Postives = 113/144 (78.47%), Query Frame = 1
Query:   10 KLMKDVEGTCSGRHGFVVAITSVENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVSMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQ-SGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVIN 438
            KL  +VEGTC+G++GFV+A+T+++NIG G+I+ G GFV +PVKY+ +VFRPFKGE+++AVV+ VNK+G F E GP+  F+S H IP +MEF  + + P Y T D  + IQ+D E+RLKI+GTRVD  +IF IG++ DD+LG+++
Sbjct:   29 KLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS 172          
BLAST of DC900187 vs. ExPASy Swiss-Prot
Match: RPB7_DANRE (DNA-directed RNA polymerase II subunit RPB7 OS=Danio rerio GN=polr2g PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.971e-44
Identity = 79/144 (54.86%), Postives = 113/144 (78.47%), Query Frame = 1
Query:   10 KLMKDVEGTCSGRHGFVVAITSVENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVSMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQ-SGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVIN 438
            KL  +VEGTC+G++GFV+A+T+++NIG G+I+ G GFV +PVKY+ +VFRPFKGE+++AVV+ VNK+G F E GP+  F+S H IP +MEF  + + P Y T D  V IQ+D E+RLKI+GTRVD  +IF IG++ DD+LG+++
Sbjct:   29 KLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTVDEDVVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS 172          
BLAST of DC900187 vs. ExPASy Swiss-Prot
Match: RPB7_BOVIN (DNA-directed RNA polymerase II subunit RPB7 OS=Bos taurus GN=POLR2G PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 4.971e-44
Identity = 78/144 (54.17%), Postives = 113/144 (78.47%), Query Frame = 1
Query:   10 KLMKDVEGTCSGRHGFVVAITSVENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVSMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQ-SGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVIN 438
            KL  +VEGTC+G++GFV+A+T+++NIG G+I+ G GFV +PVKY+ +VFRPFKGE+++AVV+ VNK+G F E GP+  F+S H IP +MEF  + + P Y T D  + IQ+D E+RLKI+GTRVD  +IF IG++ DD+LG+++
Sbjct:   29 KLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS 172          
BLAST of DC900187 vs. ExPASy Swiss-Prot
Match: RPB7_DICDI (DNA-directed RNA polymerase II subunit rpb7 OS=Dictyostelium discoideum GN=polr2g PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 9.375e-43
Identity = 81/143 (56.64%), Postives = 112/143 (78.32%), Query Frame = 1
Query:   10 KLMKDVEGTCSGRHGFVVAITSVENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVSMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQS-GDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVI 435
            +L  +VEGTC+GR+GF++ ITSV+ + KG + + +G+V F VKY+ ++F+PFKGE+L+A+V+ V  +GFFAEAGP+ IFVS  LIP DM F +   +P + + DGS KI KD EVRL+I GTRVDATEIF IG+I++D+LGVI
Sbjct:   29 QLYSEVEGTCTGRYGFIITITSVDFLSKGKVLESSGYVVFNVKYKAIIFKPFKGEVLDAIVTKVTNLGFFAEAGPLSIFVSTQLIPSDMIFDAQSAVPCFVSEDGSSKISKDDEVRLQIKGTRVDATEIFAIGSIREDYLGVI 171          
BLAST of DC900187 vs. ExPASy Swiss-Prot
Match: RPB7_SCHPO (DNA-directed RNA polymerase II subunit rpb7 OS=Schizosaccharomyces pombe GN=rpb7 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.830e-38
Identity = 76/146 (52.05%), Postives = 111/146 (76.03%), Query Frame = 1
Query:    7 SKLMKDVEGTCSGRHGFVVAI--TSVENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVSMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQ-SGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVI 435
            +KL+ DVEGTCSG++G+++ +  ++  +I KG +  G GF  F VKY+ V++RPF+GE+++A+V+ VNKMGFFA  GP+ +FVS+HL+P DM+F  + + PNY+  D    I+K S VRLKI+GTR DATEIF I T+K+D+LGV+
Sbjct:   29 AKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLWRPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGED--QVIEKGSNVRLKIVGTRTDATEIFAIATMKEDYLGVL 172          
BLAST of DC900187 vs. ExPASy Swiss-Prot
Match: RPB7_YEAST (DNA-directed RNA polymerase II subunit RPB7 OS=Saccharomyces cerevisiae GN=RPB7 PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 5.168e-25
Identity = 56/146 (38.36%), Postives = 96/146 (65.75%), Query Frame = 1
Query:    7 SKLMKDVEGTCSGRHGFVVAITSVENIG--KGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVSMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQSG-DMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVI 435
            +KL+++VEG+C+G+ G+++ +   +NI   +G I    G   F VKY+ VVF+PFKGE+++  V   ++ GF  + GP+++FV+ HL+P D+ F +G + P+Y +S+  + I+  S +R+KI G     + I  IG+IK+D+LG I
Sbjct:   28 TKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIK--SRIRVKIEGCISQVSSIHAIGSIKEDYLGAI 171          
The following BLAST results are available for this feature:
BLAST of DC900187 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
RPB7_SOYBN5.622e-8094.70DNA-directed RNA polymerase II subunit RPB7 OS=Gly... [more]
RPB7_ARATH7.112e-7590.54DNA-directed RNA polymerase II subunit RPB7 OS=Ara... [more]
RPB7_RAT4.971e-4454.17DNA-directed RNA polymerase II subunit RPB7 OS=Rat... [more]
RPB7_MOUSE4.971e-4454.17DNA-directed RNA polymerase II subunit RPB7 OS=Mus... [more]
RPB7_HUMAN4.971e-4454.17DNA-directed RNA polymerase II subunit RPB7 OS=Hom... [more]
RPB7_DANRE4.971e-4454.86DNA-directed RNA polymerase II subunit RPB7 OS=Dan... [more]
RPB7_BOVIN4.971e-4454.17DNA-directed RNA polymerase II subunit RPB7 OS=Bos... [more]
RPB7_DICDI9.375e-4356.64DNA-directed RNA polymerase II subunit rpb7 OS=Dic... [more]
RPB7_SCHPO1.830e-3852.05DNA-directed RNA polymerase II subunit rpb7 OS=Sch... [more]
RPB7_YEAST5.168e-2538.36DNA-directed RNA polymerase II subunit RPB7 OS=Sac... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900187 VSS Citrus sinensis cDNA clone VS28220 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900187 ID=DC900187|Name=DC900187|organism=Citrus sinensis|type=EST|length=749bp
ATCATCTCCAAGCTCATGAAAGATGTTGAGGGCACTTGCAGTGGACGGCA
TGGATTTGTGGTGGCGATAACGAGTGTGGAAAATATCGGGAAGGGCCTGA
TTCGGGATGGGACAGGGTTCGTGACTTTTCCGGTGAAGTACCAGTGTGTT
GTTTTTAGACCCTTTAAAGGGGAAATTTTGGAAGCTGTTGTTTCCATGGT
TAACAAGATGGGGTTTTTCGCTGAAGCTGGACCTGTTCAAATTTTTGTTT
CAAATCATTTGATACCGGATGATATGGAGTTCCAGTCAGGAGATATGCCA
AATTACACTACCTCAGATGGATCGGTGAAGATTCAAAAGGATAGTGAGGT
TCGGTTAAAGATAATTGGGACTCGAGTTGATGCCACTGAAATTTTCTGCA
TCGGTACCATAAAGGATGATTTCTTGGGAGTGATCAATGATCCTACAACG
ATCTAGTGAGGGAATAGCTCCAAGATCAACTTCACACATCTCGCTTGCTG
TTCCTTGTTGTCTAGTTTTGTAGGCCATTGATCTGCCTTCGAAGTGTTCA
TTAACGTACTTATTGCTCCGCGAAGAAGATCTTAGCTTTGTGGGTTCATT
TAGTGTAACTATGTAGTTGTACAAGATTTACTGAATGTAGTTGTGTTGAA
GGTAGTGGCAATTATTTAATGAATTTTTGGTAATTGTTTNTTCTTTTTTA
ATAAATGTTTTTCAAAGATTAACATTAATTGAAAAACTTAAGGTTTTTT
back to top