DC900180

Overview
NameDC900180
Unique NameDC900180
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length596
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1582 contig Csv1_Contig1582:410..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900180 vs. ExPASy Swiss-Prot
Match: 1433_TOBAC (14-3-3-like protein OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.072e-63
Identity = 122/147 (82.99%), Postives = 128/147 (87.07%), Query Frame = 2
Query:    2 EHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGEQSKGDEVQAES 442
            EH++PSSTSGESTVFYYKMKGDYYRYLAEFK  DDRKEAAD SLK          ++L PTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSL+EESYKDSTLIMQLLRDN TLWTSDL EEGGE SKGDE Q E+
Sbjct:  106 EHVVPSSTSGESTVFYYKMKGDYYRYLAEFKSGDDRKEAADQSLKAYEAATATASADLAPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLSEESYKDSTLIMQLLRDNFTLWTSDL-EEGGEHSKGDERQGEN 251          
BLAST of DC900180 vs. ExPASy Swiss-Prot
Match: 14337_SOLLC (14-3-3 protein 7 OS=Solanum lycopersicum GN=TFT7 PE=2 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 1.072e-63
Identity = 122/147 (82.99%), Postives = 129/147 (87.76%), Query Frame = 2
Query:    2 EHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGEQSKGDEVQAES 442
            EHL+PSST+GESTVFYYKMKGDYYRYLAEFK  DDRKEA++ SLK          S+L PTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSL+EESYKDSTLIMQLLRDNLTLWTSDL EEGGE SKGDE Q E+
Sbjct:  107 EHLVPSSTTGESTVFYYKMKGDYYRYLAEFKAGDDRKEASEQSLKAYEAATATASSDLAPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLSEESYKDSTLIMQLLRDNLTLWTSDL-EEGGEHSKGDERQGEN 252          
BLAST of DC900180 vs. ExPASy Swiss-Prot
Match: 1433D_SOYBN (14-3-3-like protein D OS=Glycine max GN=GF14D PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.093e-59
Identity = 109/139 (78.42%), Postives = 122/139 (87.77%), Query Frame = 2
Query:    2 EHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGEQSK 418
            EHLIPS+ +GESTVFYYKMKGDYYRYLAEFK  +++KEAAD S+K          ++LPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAI+ELD+LNEESYKDSTLIMQLLRDNLTLWTSD+PE+G +  K
Sbjct:  109 EHLIPSAAAGESTVFYYKMKGDYYRYLAEFKSGNEKKEAADQSMKAYESATAAAEADLPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDIPEDGEDAQK 247          
BLAST of DC900180 vs. ExPASy Swiss-Prot
Match: 1433B_VICFA (14-3-3-like protein B OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.733e-59
Identity = 109/141 (77.30%), Postives = 122/141 (86.52%), Query Frame = 2
Query:    2 EHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGEQSKGD 424
            EHLIPS+ +GESTVFYYKMKGDYYRYLAEFK  +++KEA D S+K          +ELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAI+ELD+LNEESYKDSTLIMQLLRDNLTLWTSD+PE+G +  K +
Sbjct:  109 EHLIPSAAAGESTVFYYKMKGDYYRYLAEFKTGNEKKEAGDQSMKAYESATTAAEAELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDIPEDGEDSQKAN 249          
BLAST of DC900180 vs. ExPASy Swiss-Prot
Match: 14312_ARATH (14-3-3-like protein GF14 iota OS=Arabidopsis thaliana GN=GRF12 PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 6.090e-59
Identity = 113/147 (76.87%), Postives = 126/147 (85.71%), Query Frame = 2
Query:    2 EHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGEQS-KGDEVQAE 439
            +HLIP +TSGE+TVFYYKMKGDYYRYLAEFK   +RKEAA+ SLK          +ELP THPIRLGLALNFSVFYYEI+NSPERACHLAKQAFDEAIAELD+L+EESYKDSTLIMQLLRDNLTLWTSDLPE+GGE + K +E + E
Sbjct:  112 QHLIPHATSGEATVFYYKMKGDYYRYLAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDLPEDGGEDNIKTEESKQE 258          
BLAST of DC900180 vs. ExPASy Swiss-Prot
Match: 1433C_SOYBN (14-3-3-like protein C OS=Glycine max GN=GF14C PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 1.357e-58
Identity = 112/146 (76.71%), Postives = 126/146 (86.30%), Query Frame = 2
Query:    2 EHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGEQSKGDEVQAE 439
            E+LIPSS+SGE +VF+YKMKGDYYRYLAEFK  D+RKEAADHS+K          +EL  THPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAI+ELD+L+EESYKDSTLIMQLLRDNLTLWTSD+PE+G EQ K D  +A+
Sbjct:  109 EYLIPSSSSGEPSVFFYKMKGDYYRYLAEFKSGDERKEAADHSMKAYQLASTTAEAELASTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDIPEDGEEQ-KVDSARAD 253          
BLAST of DC900180 vs. ExPASy Swiss-Prot
Match: 14339_SOLLC (14-3-3 protein 9 OS=Solanum lycopersicum GN=TFT9 PE=2 SV=2)

HSP 1 Score: 223.402 bits (568), Expect = 6.733e-58
Identity = 108/141 (76.60%), Postives = 121/141 (85.82%), Query Frame = 2
Query:    2 EHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGEQSKGD 424
            +HLIPS ++GESTVFY+KMKGDYYRYLAEFK  +D+KE A+ SLK          +EL PTHPIRLGLALNFSVFYYEI+NSPERACHLAKQAFDEAI+ELDSLNE+SYKDSTLIMQLLRDNLTLWTSDLPE+  +  KGD
Sbjct:  109 QHLIPSCSAGESTVFYHKMKGDYYRYLAEFKAGNDKKEVAELSLKAYQAATTAAEAELAPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDSLNEDSYKDSTLIMQLLRDNLTLWTSDLPEDAEDAQKGD 249          
BLAST of DC900180 vs. ExPASy Swiss-Prot
Match: 14339_ARATH (14-3-3-like protein GF14 mu OS=Arabidopsis thaliana GN=GRF9 PE=1 SV=2)

HSP 1 Score: 223.016 bits (567), Expect = 8.793e-58
Identity = 107/138 (77.54%), Postives = 121/138 (87.68%), Query Frame = 2
Query:    2 EHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGEQS 415
            EHLIPS++ GESTVF+ KMKGDYYRYLAEFK  ++RKEAAD SLK          ++LPPTHPIRLGLALNFSVFYYEI+N+PERACHLAKQAFDEAI+ELD+LNEESYKDSTLIMQLLRDNLTLWTSD+ EEGG+ +
Sbjct:  109 EHLIPSASEGESTVFFNKMKGDYYRYLAEFKSGNERKEAADQSLKAYEIATTAAEAKLPPTHPIRLGLALNFSVFYYEIMNAPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDISEEGGDDA 246          
BLAST of DC900180 vs. ExPASy Swiss-Prot
Match: 14338_SOLLC (14-3-3 protein 8 OS=Solanum lycopersicum GN=TFT8 PE=2 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.148e-57
Identity = 108/141 (76.60%), Postives = 119/141 (84.40%), Query Frame = 2
Query:    2 EHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGEQSKGD 424
            EHLIPS T+GESTVFYYKMKGDYYRYLAEFK  DD+KE +D SLK          +ELP THPIRLGLALNFSVFYYEI+NSPERAC LAKQ FDEAI+ELDSLNE++YKD TLI+QLLRDNLTLWTSD+PE+G E  KGD
Sbjct:  109 EHLIPSCTAGESTVFYYKMKGDYYRYLAEFKTGDDKKEVSDLSLKAYQTATTTAEAELPITHPIRLGLALNFSVFYYEIMNSPERACQLAKQVFDEAISELDSLNEDNYKDGTLILQLLRDNLTLWTSDIPEDGEEAPKGD 249          
BLAST of DC900180 vs. ExPASy Swiss-Prot
Match: 14310_ARATH (14-3-3-like protein GF14 epsilon OS=Arabidopsis thaliana GN=GRF10 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 6.302e-56
Identity = 111/148 (75.00%), Postives = 122/148 (82.43%), Query Frame = 2
Query:    2 EHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGEQSKG-DEVQAES 442
            +HLIPSS + ESTVF+YKMKGDYYRYLAEF    +RKEAAD SL+          + L PTHP+RLGLALNFSVFYYEILNSPE AC LAKQAFD+AIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDL EEG E++KG DE Q E+
Sbjct:  107 KHLIPSSNAVESTVFFYKMKGDYYRYLAEFSSGAERKEAADQSLEAYKAAVAAAENGLAPTHPVRLGLALNFSVFYYEILNSPESACQLAKQAFDDAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLNEEGDERTKGADEPQDEN 254          
The following BLAST results are available for this feature:
BLAST of DC900180 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 143
Match NameE-valueIdentityDescription
1433_TOBAC1.072e-6382.9914-3-3-like protein OS=Nicotiana tabacum PE=2 SV=1[more]
14337_SOLLC1.072e-6382.9914-3-3 protein 7 OS=Solanum lycopersicum GN=TFT7 P... [more]
1433D_SOYBN2.093e-5978.4214-3-3-like protein D OS=Glycine max GN=GF14D PE=2... [more]
1433B_VICFA2.733e-5977.3014-3-3-like protein B OS=Vicia faba PE=2 SV=1[more]
14312_ARATH6.090e-5976.8714-3-3-like protein GF14 iota OS=Arabidopsis thali... [more]
1433C_SOYBN1.357e-5876.7114-3-3-like protein C OS=Glycine max GN=GF14C PE=2... [more]
14339_SOLLC6.733e-5876.6014-3-3 protein 9 OS=Solanum lycopersicum GN=TFT9 P... [more]
14339_ARATH8.793e-5877.5414-3-3-like protein GF14 mu OS=Arabidopsis thalian... [more]
14338_SOLLC1.148e-5776.6014-3-3 protein 8 OS=Solanum lycopersicum GN=TFT8 P... [more]
14310_ARATH6.302e-5675.0014-3-3-like protein GF14 epsilon OS=Arabidopsis th... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900180 VSS Citrus sinensis cDNA clone VS28206 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900180 ID=DC900180|Name=DC900180|organism=Citrus sinensis|type=EST|length=596bp
TGAACACCTAATCCCATCCTCCACATCTGGAGAATCAACCGTGTTTTACT
ATAAGATGAAAGGAGATTATTACCGTTACCTAGCTGAGTTCAAAGGTGCT
GATGATCGTAAGGAAGCTGCAGATCATTCACTTAAGGCTTACGAGGCTGC
TACAGCTGCAGCAGCCTCAGAGTTACCCCCAACTCATCCAATCAGACTTG
GCCTGGCTCTTAACTTTTCTGTTTTCTACTATGAGATTTTGAACTCACCT
GAGAGGGCTTGCCACCTGGCTAAACAAGCATTTGATGAGGCTATTGCTGA
ACTTGATAGCCTTAATGAAGAGTCCTACAAGGACAGCACCCTTATTATGC
AGCTTCTTCGGGATAATCTCACCTTGTGGACCTCGGATCTACCGGAGGAG
GGAGGTGAGCAATCTAAAGGTGATGAAGTTCAAGCAGAGAGCTAGCCGGG
GATGCATGAGCATCAGGAGGAGAAATTGTGCTAGTTGGGTTCTAATATCT
ATTAGTATTAGTAGTATAGGGATTGAAAGAACATTTGGCTTGTATAATAC
TTATTACATGTTTTTAATTTCAGGTTGTTGTGCTATTTTCTGTTTA
back to top