CN186120

Overview
NameCN186120
Unique NameCN186120
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length772
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12567 contig Csv1_Contig12567:808..1579. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186120 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.949e-63
Identity = 121/121 (100.00%), Postives = 121/121 (100.00%), Query Frame = -3
Query:  408 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 770
            DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL
Sbjct:  225 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 345          
BLAST of CN186120 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.282e-58
Identity = 111/121 (91.74%), Postives = 117/121 (96.69%), Query Frame = -3
Query:  408 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 770
            DPNVMEAKVVVSSCGHDGPFGATGVK L+SIGMI+ VPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNALDG+YVGG+HPELIL
Sbjct:  221 DPNVMEAKVVVSSCGHDGPFGATGVKSLRSIGMIDTVPGMKALDMNVAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIHPELIL 341          
BLAST of CN186120 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 5.955e-56
Identity = 107/121 (88.43%), Postives = 114/121 (94.21%), Query Frame = -3
Query:  408 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 770
            DPNVMEAK+VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALK+LG PNA+DGT VG + PEL+L
Sbjct:  218 DPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVL 338          
BLAST of CN186120 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.051e-52
Identity = 103/121 (85.12%), Postives = 111/121 (91.74%), Query Frame = -3
Query:  408 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 770
            DPNVMEAKVVVSSCGHDGPFGATGVKRL+ IGMI  VPGMKALDMN+AED IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DGT    +  EL++
Sbjct:  224 DPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLREELMI 344          
BLAST of CN186120 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 3.994e-52
Identity = 101/110 (91.82%), Postives = 106/110 (96.36%), Query Frame = -3
Query:  441 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGT 770
            DPNVMEAKVVVSSCGHDGPFGATGVKRL+ IGMI  VPGMKALDMN+AED IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DGT
Sbjct:  221 DPNVMEAKVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGT 330          
BLAST of CN186120 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.633e-29
Identity = 64/99 (64.65%), Postives = 80/99 (80.81%), Query Frame = -3
Query:  474 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 770
            DPN + A +V+S+ GHD P GA  VKRL S+G IE++ GM+ LDMN AEDAIV+ TRE+VPG+IV GME++E+DGA RMGPTFGAM++SG KAA  ALK
Sbjct:  215 DPNTINAPLVISTTGHDAPMGAFCVKRLVSMGRIEKLGGMRGLDMNVAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGLKAAEEALK 313          
BLAST of CN186120 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 4.751e-29
Identity = 62/99 (62.63%), Postives = 79/99 (79.80%), Query Frame = -3
Query:  474 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 770
            DPN + A V++S+ GHDGPFGA   KRL S+G ++++ GM+ LDMNSAEDAIV+ TREV  G+I+ GME++EIDG  RMGPTFGAM++SG KAA  ALK
Sbjct:  218 DPNTINAPVIISTTGHDGPFGAFCAKRLVSMGSVDKLGGMRGLDMNSAEDAIVKNTREVTKGLIIGGMELSEIDGFNRMGPTFGAMVLSGVKAAEEALK 316          
BLAST of CN186120 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 127.872 bits (320), Expect = 6.205e-29
Identity = 63/99 (63.64%), Postives = 79/99 (79.80%), Query Frame = -3
Query:  474 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 770
            DPN + A +++S+ GHDGP GA  VKRL S+  IE++ GM+ LDMN AEDAIV+ TRE+VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK
Sbjct:  211 DPNTINAPLIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALK 309          
BLAST of CN186120 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 1.528e-27
Identity = 64/112 (57.14%), Postives = 78/112 (69.64%), Query Frame = -3
Query:  435 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYV 770
            DPN + A +VVS+ GHDGPFGA  VKRL S  ++  +  M+ LDMN AED IV+ TREV PGMIV GME++E DGA RMGPTFG MM SG KAA  AL    +  A++  Y+
Sbjct:  217 DPNTINAHLVVSATGHDGPFGAFCVKRLASAQLVSNLHDMRPLDMNRAEDLIVKGTREVFPGMIVGGMELSEFDGANRMGPTFGGMMFSGIKAAQEALAIFDERKAVNEKYL 328          
BLAST of CN186120 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.808e-27
Identity = 60/113 (53.10%), Postives = 81/113 (71.68%), Query Frame = -3
Query:  432 DPNVMEAKVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVG 770
            DP+ + A +V S  GHDGPFGA  VKR+ S G+ E +  M+ LDM  AED I   TRE++PG+IV GME++E DG+ RMGPTFGAM++SG++AA +AL+SL +    +G  VG
Sbjct:  223 DPSTITAPLVCSFAGHDGPFGAFCVKRVASAGLSEGLGDMRPLDMERAEDHIANKTREILPGLIVGGMELSEFDGSARMGPTFGAMLLSGKRAAEVALQSLDRVKIEEGEVVG 335          
The following BLAST results are available for this feature:
BLAST of CN186120 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
THI4_CITSI2.949e-63100.00Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL1.282e-5891.74Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH5.955e-5688.43Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE1.051e-5285.12Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE3.994e-5291.82Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI4_FUSSH1.633e-2964.65Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_ASPOR4.751e-2962.63Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]
THI4_FUSOX6.205e-2963.64Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI2_SCHPO1.528e-2757.14Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]
THI4_UROFA5.808e-2753.10Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002G10_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002G10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186120 ID=CN186120|Name=CN186120|organism=Citrus sinensis|type=EST|length=772bp
TTTTTTTTTTTTTGATCTTATCACATCAGCACTTTCCCATTGCCTTTTGG
CTCAAGTTATAAACATACAAAGCAAAGAAAAGGGCCCTGCCCAAGGGCAG
TCTTACACATAACACAGATAACAAGGACTAGATACGCAACTGCAAATTCA
CCTCCGAAAAACTCACAACGGTTTCTTACAAGAGGAGAAAGAAATTAAAA
TTAAAGGTTCGATGATGGACCGGAAACAAACACTTTATTCACAAAACCTC
ACAACATTATCTCATTATTCGCATCAACCATCCATCACAACCACCTAAAT
ACAACTACTTTTTTGCCAGAGTTTATTTGCATGCACACAGCTGATGAGTG
ATGATGCCTGTTATTACCAAATTAAGCATCAGCAGTCTCAGCAGAATCAG
CTGCAGCTAAGATCAGCTCAGGGTGAACGCCTCCCACATATGTACCGTCT
AATGCATTCGGCTGGCCCAGTGACTTCAACGCCAAATGCGCAGCCTTCTG
CCCCGATATCATCATTGCTCCAAATGTTGGCCCCATTCGAGGAGCACCAT
CAATCTCGGCAACTTCCATGCCGGTAACTATCATACCAGGCACAACCTCC
CTGGTCAGCCTCACAATAGCATCTTCTGCAGAGTTCATGTCCAGTGCCTT
CATTCCAGGCACTTCCTCAATCATTCCGATACTCTTCAACCTCTTTACTC
CAGTGGCCCCAAAAGGCCCATCATGGCCACAAGAGCTCACAACCACCTTC
GCTTCCATTACATTGGGATCCA
back to top