DC900173

Overview
NameDC900173
Unique NameDC900173
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length461
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12716 contig Csv1_Contig12716:319..779. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900173 vs. ExPASy Swiss-Prot
Match: PHLB_PHLPR (Pollen allergen Phl p 11 OS=Phleum pratense PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 6.463e-15
Identity = 37/88 (42.05%), Postives = 52/88 (59.09%), Query Frame = 3
Query:    9 EGKTDSTGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSE-TRYANSMGFMKAEPMSGCAEVLRLYQEED 269
            E  TD  G YKI + +DHQ+++C+ VL  SP   C  +   R+R+RV LTS NGI  +  RYAN + F + EP+  C  +L+ Y   D
Sbjct:   51 EATTDGLGWYKIEIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFRKEPLKECGGILQAYDLRD 138          
BLAST of DC900173 vs. ExPASy Swiss-Prot
Match: LAT52_SOLLC (Anther-specific protein LAT52 OS=Solanum lycopersicum GN=LAT52 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.189e-14
Identity = 34/82 (41.46%), Postives = 51/82 (62.20%), Query Frame = 3
Query:    3 SREGKTDSTGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPMSGCAEVL 248
            S EG TD  G YK+ V+ DH++ +C+  ++ SP+ DCK    G E++R+  +   GI +  R+AN + FMKAE + GC E L
Sbjct:   70 SVEGVTDKDGKYKLTVNGDHENDICEVTVVKSPREDCKESVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESVQGCKEAL 151          
BLAST of DC900173 vs. ExPASy Swiss-Prot
Match: PSC13_MAIZE (Pollen-specific protein C13 OS=Zea mays GN=MGS1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.471e-14
Identity = 35/87 (40.23%), Postives = 54/87 (62.07%), Query Frame = 3
Query:    9 EGKTDSTGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPMSGCAEVLRLYQEED 269
            +G TD+TGTY I + + H++ +C  VL++SP+ DC  V   R+R+ V+LT   GIS   R AN +G+ K  P+  CA +L+    +D
Sbjct:   80 DGVTDATGTYTIELKDSHEEDICQVVLVASPRKDCDEVQALRDRAGVLLTRNVGISDSLRPANPLGYFKDVPLPVCAALLKQLDSDD 166          
BLAST of DC900173 vs. ExPASy Swiss-Prot
Match: LOLB_LOLPR (Major pollen allergen Lol p 11 OS=Lolium perenne PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.145e-14
Identity = 35/84 (41.67%), Postives = 50/84 (59.52%), Query Frame = 3
Query:    9 EGKTDSTGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSE-TRYANSMGFMKAEPMSGCAEVLRLY 257
            E  TD  G YKI + +DHQ+++C+ VL  SP   C  +   R+R+RV LTS  GI  +  RYAN + F + EP+  C  +L+ Y
Sbjct:   51 EATTDKDGWYKIEIDQDHQEEICEVVLAKSPDKSCSEIEEFRDRARVPLTSNXGIKQQGIRYANPIAFFRKEPLKECGGILQAY 134          
BLAST of DC900173 vs. ExPASy Swiss-Prot
Match: OLEE1_BETVE (Olee1-like protein OS=Betula verrucosa PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.546e-13
Identity = 35/86 (40.70%), Postives = 54/86 (62.79%), Query Frame = 3
Query:    3 SREGKTDSTGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAPG---RERSRVILTSYNGISSETRYANSMGFMKAEPMSGCAEVLR 251
            S + +TD +GTY+I V  DH++++C+  L  S   DC  V+     ++ +R+ LT  NGIS+  R AN +GFMK +P+  CA+ LR
Sbjct:   70 SSDSETDKSGTYRIPVDGDHEEEICEIALKKSSDPDCSEVSKDPFLKKSARISLTKNNGISTPVRLANPLGFMKKKPLPECAKALR 155          
BLAST of DC900173 vs. ExPASy Swiss-Prot
Match: CHE1_CHEAL (Pollen allergen Che a 1 OS=Chenopodium album PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.348e-12
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 3
Query:    9 EGKTDSTGTYKILVSEDHQDQLCDAVLISSPQNDCKTVAP---GRERSRVILTSYNGISSETRYANSMGFMKAEPMSGCAEVLRLYQEEDV 272
            E  TD  G Y I V+ D +D +C+  L+ SP ++C  V+     ++ ++V LTS NG +S+ R AN++GFM+ EP+  C EVL+     DV
Sbjct:   75 EAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEPLKECPEVLKELDLYDV 165          
The following BLAST results are available for this feature:
BLAST of DC900173 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PHLB_PHLPR6.463e-1542.05Pollen allergen Phl p 11 OS=Phleum pratense PE=1 S... [more]
LAT52_SOLLC4.189e-1441.46Anther-specific protein LAT52 OS=Solanum lycopersi... [more]
PSC13_MAIZE5.471e-1440.23Pollen-specific protein C13 OS=Zea mays GN=MGS1 PE... [more]
LOLB_LOLPR7.145e-1441.67Major pollen allergen Lol p 11 OS=Lolium perenne P... [more]
OLEE1_BETVE3.546e-1340.70Olee1-like protein OS=Betula verrucosa PE=2 SV=1[more]
CHE1_CHEAL1.348e-1239.56Pollen allergen Che a 1 OS=Chenopodium album PE=1 ... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900173 VSS Citrus sinensis cDNA clone VS27V95 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900173 ID=DC900173|Name=DC900173|organism=Citrus sinensis|type=EST|length=461bp
ATAGCAGGGAAGGGAAAACAGACTCAACTGGAACATATAAGATCCTCGTT
TCAGAAGACCATCAGGATCAACTTTGCGATGCTGTCCTCATTAGTAGCCC
CCAGAATGACTGCAAAACAGTTGCCCCAGGGCGTGAGCGTTCCCGTGTGA
TCTTGACCAGTTACAACGGCATTTCTTCTGAAACCCGATATGCCAATTCA
ATGGGCTTCATGAAGGCAGAGCCCATGTCTGGCTGTGCTGAGGTTCTCAG
GCTATATCAGGAGGAGGATGTGTAGAGAATGGTGTGGCATGGTTTTTTCT
ATCGCTTTCCATTTGTTTAAGCTTTGTGTTGCCTTATACTGTCTCTTCTA
TTAGTAGTGCCCGGATGGCTGTGTTGNTTCTATGTTTAGAGAATTCTTAA
TTTGTTGTTAAAGGACGCGNACGCTATTAATTTATTTATATGCTGGNGCT
TCTAGCTTTGA
back to top