CN186117

Overview
NameCN186117
Unique NameCN186117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length758
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN186117 vs. ExPASy Swiss-Prot
Match: PAO_ARATH (Pheophorbide a oxygenase, chloroplastic OS=Arabidopsis thaliana GN=PAO PE=1 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 6.820e-65
Identity = 121/175 (69.14%), Postives = 142/175 (81.14%), Query Frame = -2
Query:  239 WHEHWTSNKVYDGDMIVLQGQEKIFLSKSMEGSE-DVNKEYTKITFTPTQADRFVLAFRNWLRRHGNSQPEWFGFS-SQQPSPSTVLSKRQMLDRFEQHTLKCSSCREAYSAFQTGQKFLIGATVAFCATAGIPSDLQSRIVXXXXXXXXXXXXXXLHELQKNFVFVDYVHAEID 757
            W+EHWTSN VYDGDMIVLQGQEK+FL+KSME  + DVNK+YTK+TFTPTQADRFVLAFRNWLRRHG SQPEWFG + S QP PSTVL+KRQMLDRF+QHT  CSSC+ AY++FQ  +KFL+GATV + ATAG+PSD+Q R+V              LHE +KNFVF DYVH+EI+
Sbjct:  363 WYEHWTSNLVYDGDMIVLQGQEKVFLAKSMESPDYDVNKQYTKLTFTPTQADRFVLAFRNWLRRHGKSQPEWFGSTPSNQPLPSTVLTKRQMLDRFDQHTQVCSSCKGAYNSFQILKKFLVGATVFWAATAGVPSDVQIRLVLAGLSLISAASAYALHEQEKNFVFRDYVHSEIE 537          
The following BLAST results are available for this feature:
BLAST of CN186117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PAO_ARATH6.820e-6569.14Pheophorbide a oxygenase, chloroplastic OS=Arabido... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002G08_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186117 ID=CN186117|Name=CN186117|organism=Citrus sinensis|type=EST|length=758bp
CGTGTTTAATCCATTTACTCATGAATTTGGATCCATGTCTGCACATATTT
ATCTGATGACATTCATTTGGCACAAAAACAAAGGGAATACTGAGGAAACA
CTCTAAGCTTAGCTATCACACTGATTTCTATCTAATAGATATATACAAAC
TCGCAAATTTTGACAAGATTTATCACCATATCTTTCTTATACCTCTGGAC
ACAATGATTCTTTCAGCAGCATATCTACTCCCTCTCTAATCGATTTCAGC
ATGCACATAATCAACAAACACAAAATTCTTTTGTAGTTCATGCAAAGCAT
AAGCCAAGGCAGCGCTCACTAGCGCAAGCCCAGCCAAAACAATCCGTGAT
TGCAAATCTGAAGGAATCCCAGCTGTTGCACAGAATGCAACAGTCGCGCC
AATGAGAAACTTTTGCCCCGTCTGGAATGCTGAATAAGCTTCTCTACATG
ATGAACACTTGAGGGTGTGTTGCTCAAATCTATCGAGCATCTGTCGTTTC
GACAAGACTGTTGATGGGGAAGGTTGTTGGCTGCTGAAGCCAAACCATTC
AGGTTGGCTGTTGCCGTGTCGCCTCAGCCAATTTCTAAATGCCAACACAA
ACCGATCTGCCTGTGTGGGTGTAAATGTAATTTTTGTGTACTCCTTGTTA
ACATCTTCAGAACCTTCCATCGATTTTGAAAGAAAGATCTTCTCTTGACC
TTGGAGGACAATCATGTCTCCATCATAGACCTTATTTGAAGTCCAATGCT
CGTGCCAT
back to top