DC900170

Overview
NameDC900170
Unique NameDC900170
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length793
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA13_ARATH (Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.680e-50
Identity = 79/118 (66.95%), Postives = 96/118 (81.36%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQESAKDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q   Q+ +LL LQ + RSIF V E  K+T+IFNTFV CQ+FNEFNAR LEKKN+FKG+HKN+LF+ II +T+VLQ++MVEFLK+FADTERLN GQW  CI IAA SWPIG+L K +PV
Sbjct:  885 QAFYQISVLLVLQFRGRSIFNVTEKVKNTLIFNTFVLCQVFNEFNARSLEKKNVFKGLHKNRLFIGIIVVTVVLQVVMVEFLKRFADTERLNLGQWGVCIAIAAASWPIGWLVKSVPV 1002          

HSP 2 Score: 46.9802 bits (110), Expect = 2.680e-50
Identity = 25/43 (58.14%), Postives = 28/43 (65.12%), Query Frame = 2
Query:   83 VPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSEP 208
            VPLTAVQLLWV LIM       +ATE+P  DLM K P+ R  P
Sbjct:  830 VPLTAVQLLWVNLIMDTLGALALATEKPTNDLMKKKPIGRVAP 872          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA12_ARATH (Putative calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 8.397e-49
Identity = 79/119 (66.39%), Postives = 97/119 (81.51%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQESAKDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPVS 603
            Q + Q+ +LL LQ K  SIF V++  KDT+IFNTFV CQ+FNEFNAR++EKKN+FKG+H+N+LF+ II ITIVLQ+IMVEFLKKFADT RLN  QW  CI +A++SWPIGF  K IPVS
Sbjct:  889 QSLYQIAVLLILQFKGMSIFSVRKEVKDTLIFNTFVLCQVFNEFNAREMEKKNVFKGLHRNRLFIGIIAITIVLQVIMVEFLKKFADTVRLNGWQWGTCIALASLSWPIGFFTKFIPVS 1007          

HSP 2 Score: 44.669 bits (104), Expect = 8.397e-49
Identity = 23/43 (53.49%), Postives = 30/43 (69.77%), Query Frame = 2
Query:   80 KVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSE 205
            +VPLTAVQLLWV LIM       +ATE+P  +L+ + PV R+E
Sbjct:  833 EVPLTAVQLLWVNLIMDTLGALALATERPTNELLKRKPVGRTE 875          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA8_ARATH (Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 4.720e-41
Identity = 69/125 (55.20%), Postives = 88/125 (70.40%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQESA-------KDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q I QV +LLTL  +  SI G++          K+T+IFN FV CQ FNEFNARK ++KNIFKG+ KN+LF+ II IT+VLQ+I+VEFL KFA T +LNW QW  C+GI  +SWP+  + K IPV
Sbjct:  923 QAIYQVSVLLTLNFRGISILGLEHEVHEHATRVKNTIIFNAFVLCQAFNEFNARKPDEKNIFKGVIKNRLFMGIIVITLVLQVIIVEFLGKFASTTKLNWKQWLICVGIGVISWPLALVGKFIPV 1047          

HSP 2 Score: 49.2914 bits (116), Expect = 4.720e-41
Identity = 27/46 (58.70%), Postives = 29/46 (63.04%), Query Frame = 2
Query:   74 SXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSEP 208
            S  VPLTAVQLLWV LIM       +ATE P   LM +PPV R EP
Sbjct:  865 SGDVPLTAVQLLWVNLIMDTLGALALATEPPTDHLMGRPPVGRKEP 910          

HSP 3 Score: 21.1718 bits (43), Expect = 4.720e-41
Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 3
Query:  207 PLIPNLMXRNLI 242
            PLI N+M RNL+
Sbjct:  910 PLITNIMWRNLL 921          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA10_ARATH (Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2)

HSP 1 Score: 126.716 bits (317), Expect = 8.176e-36
Identity = 62/123 (50.41%), Postives = 85/123 (69.11%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQ-----ESAKDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q + QV +LL L  +  SI  ++     E  K+T+IFN FV CQ+FNEFNARK ++ NIF+G+ +N LF+ II ITIVLQ+++VEFL  FA T +L+W  W  CIGI ++SWP+  + K IPV
Sbjct:  927 QAMYQVTVLLILNFRGISILHLKSKPNAERVKNTVIFNAFVICQVFNEFNARKPDEINIFRGVLRNHLFVGIISITIVLQVVIVEFLGTFASTTKLDWEMWLVCIGIGSISWPLAVIGKLIPV 1049          

HSP 2 Score: 45.4394 bits (106), Expect = 8.176e-36
Identity = 25/44 (56.82%), Postives = 28/44 (63.64%), Query Frame = 2
Query:   80 KVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSEP 208
            +VPLTAVQLLWV LIM       +ATE P   LM + PV R EP
Sbjct:  871 EVPLTAVQLLWVNLIMDTLGALALATEPPTDHLMDRAPVGRREP 914          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA9_ARATH (Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 6.772e-35
Identity = 63/125 (50.40%), Postives = 81/125 (64.80%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQES-------AKDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q   QV +LL L     SI G+           K+TMIFN FV CQIFNEFNARK ++ N+F+G++KN LF+AI+G+T +LQ+I+V FL KFA T RL W  W A I I  +SWP+  + K IPV
Sbjct:  940 QSFYQVAVLLVLNFAGLSILGLNHENHAHAVEVKNTMIFNAFVMCQIFNEFNARKPDEMNVFRGVNKNPLFVAIVGVTFILQIIIVTFLGKFAHTVRLGWQLWLASIIIGLVSWPLAIVGKLIPV 1064          

HSP 2 Score: 43.5134 bits (101), Expect = 6.772e-35
Identity = 26/57 (45.61%), Postives = 31/57 (54.39%), Query Frame = 2
Query:   41 AALSSIWCCCFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSEP 208
            A + ++     S  VPL AVQLLWV LIM       +ATE P   LM + PV R EP
Sbjct:  871 ALIINVVAAMSSGDVPLKAVQLLWVNLIMDTLGALALATEPPTDHLMHRTPVGRREP 927          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA5_ORYSJ (Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 3.177e-31
Identity = 52/126 (41.27%), Postives = 83/126 (65.87%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQ----ESAKDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV-SGE 609
            Q + Q+ +L  L     S+  ++    +S  +T+IFN+FVFCQ+FNE N+R+++K N+F+GI  N +F+A+I  T+  Q++++EFL  FA T  LNW  W   +G+ ++S  +G + KCIPV SGE
Sbjct:  874 QSLYQLFVLGALMFGGESLLNIKGADSKSIINTLIFNSFVFCQVFNEINSREMQKINVFRGIISNWIFIAVIAATVAFQVVIIEFLGTFASTVPLNWQHWLLSVGLGSISLIVGVILKCIPVGSGE 999          

HSP 2 Score: 47.3654 bits (111), Expect = 3.177e-31
Identity = 24/52 (46.15%), Postives = 31/52 (59.62%), Query Frame = 2
Query:   68 CFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSEPSDTK 220
            C +   PLTAVQLLWV +IM       +ATE P  ++M +PPV + E   TK
Sbjct:  814 CITGSAPLTAVQLLWVNMIMDTLGALALATEPPNDEMMKRPPVRKGESFITK 865          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA4_ORYSJ (Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.624e-30
Identity = 47/99 (47.47%), Postives = 72/99 (72.73%), Query Frame = 1
Query:  316 ESAKDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV-SGE 609
            +S  +T+IFN+FVFCQ+FNE N+R+++K N+F+GI  N +F+A+I  T+  Q++++EFL  FA T  LNW  W   +G+ ++S  +G + KCIPV SGE
Sbjct:  923 KSIINTLIFNSFVFCQVFNEINSREMQKINVFRGIISNWIFIAVIAATVAFQVVIIEFLGTFASTVPLNWQHWLLSVGLGSISLIVGVILKCIPVGSGE 1021          

HSP 2 Score: 46.2098 bits (108), Expect = 2.624e-30
Identity = 24/52 (46.15%), Postives = 30/52 (57.69%), Query Frame = 2
Query:   68 CFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSEPSDTK 220
            C     PLTAVQLLWV +IM       +ATE P  ++M +PPV + E   TK
Sbjct:  836 CIIGSAPLTAVQLLWVNMIMDTLGALALATEPPNDEMMKRPPVRKGESFITK 887          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA1_ARATH (Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3)

HSP 1 Score: 107.071 bits (266), Expect = 7.544e-30
Identity = 53/122 (43.44%), Postives = 79/122 (64.75%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQESAKD----TMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q + Q+ I+  LQ K +++FG+     D    T+IFN FVFCQ+FNE ++R++EK ++FKGI KN +F+A++  T+V Q+I++E L  FADT  LN GQW   I +  +  P+    K IPV
Sbjct:  896 QSLYQLVIIWCLQTKGKTMFGLDGPDSDLTLNTLIFNIFVFCQVFNEISSREMEKIDVFKGILKNYVFVAVLTCTVVFQVIIIELLGTFADTTPLNLGQWLVSIILGFLGMPVAAALKMIPV 1017          

HSP 2 Score: 45.0542 bits (105), Expect = 7.544e-30
Identity = 24/54 (44.44%), Postives = 30/54 (55.56%), Query Frame = 2
Query:   41 AALSSIWCCCFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVAR 199
            A + +    C +   PLTAVQLLWV +IM       +ATE P  DLM + PV R
Sbjct:  827 ALIVNFLSACLTGNAPLTAVQLLWVNMIMDTLGALALATEPPQDDLMKRSPVGR 880          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA1_ORYSJ (Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.032e-28
Identity = 50/122 (40.98%), Postives = 78/122 (63.93%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQ----ESAKDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q   Q  ++  LQ + +S+FG+     E   +T+IFN+FVFCQ+FNE ++R++EK N+ +GI KN +FL ++  T+V Q IMV+FL +FA+T  L   QW A + +  +  PI  + K +PV
Sbjct:  896 QSFYQFIVMWYLQTQGKSMFGLDGPDAEVVLNTIIFNSFVFCQVFNEISSREMEKINVLRGILKNYVFLGVLTSTVVFQFIMVQFLGEFANTIPLTRLQWIASVLLGLIGMPISAIIKLLPV 1017          

HSP 2 Score: 48.1358 bits (113), Expect = 3.032e-28
Identity = 26/55 (47.27%), Postives = 32/55 (58.18%), Query Frame = 2
Query:   41 AALSSIWCCCFSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARS 202
            A L +    CF+   PLTAVQLLWV +IM       +ATE P  DLM + PV R+
Sbjct:  827 ALLVNFSSACFTGNAPLTAVQLLWVNMIMDTLGALALATEPPNDDLMKREPVGRT 881          
BLAST of DC900170 vs. ExPASy Swiss-Prot
Match: ACA3_ORYSJ (Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 5.513e-27
Identity = 50/122 (40.98%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  247 QXIXQVPILLTLQXKXRSIFGVQ----ESAKDTMIFNTFVFCQIFNEFNARKLEKKNIFKGIHKNKLFLAIIGITIVLQLIMVEFLKKFADTERLNWGQWAACIGIAAMSWPIGFLFKCIPV 600
            Q I Q+ +L  L  + +S+  +     +S  +T +FNTFVFCQ+FNE N+R++EK N+F GI  + +F A++G+T   Q+IMVE L  FA+T  L+   W   + I ++   IG + KCIPV
Sbjct:  899 QSIYQLVVLGVLLLRGKSLLQINGPQADSLLNTFVFNTFVFCQVFNEVNSREMEKINVFSGIFSSWIFSAVVGVTAGFQVIMVELLGTFANTVHLSGKLWLTSVLIGSVGLVIGAILKCIPV 1020          

HSP 2 Score: 43.5134 bits (101), Expect = 5.513e-27
Identity = 24/51 (47.06%), Postives = 29/51 (56.86%), Query Frame = 2
Query:   71 FSXKVPLTAVQLLWVXLIMXPWXH-GMATEQPXKDLMSKPPVARSEPSDTK 220
            F+   PLT VQLLWV LIM       +ATE P   +M +PPV R +   TK
Sbjct:  840 FTGSAPLTIVQLLWVNLIMDTLGALALATEPPNDAMMKRPPVGRGDNFITK 890          
The following BLAST results are available for this feature:
BLAST of DC900170 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
ACA13_ARATH2.680e-5066.95Putative calcium-transporting ATPase 13, plasma me... [more]
ACA12_ARATH8.397e-4966.39Putative calcium-transporting ATPase 12, plasma me... [more]
ACA8_ARATH4.720e-4155.20Calcium-transporting ATPase 8, plasma membrane-typ... [more]
ACA10_ARATH8.176e-3650.41Calcium-transporting ATPase 10, plasma membrane-ty... [more]
ACA9_ARATH6.772e-3550.40Calcium-transporting ATPase 9, plasma membrane-typ... [more]
ACA5_ORYSJ3.177e-3141.27Probable calcium-transporting ATPase 5, plasma mem... [more]
ACA4_ORYSJ2.624e-3047.47Probable calcium-transporting ATPase 4, plasma mem... [more]
ACA1_ARATH7.544e-3043.44Calcium-transporting ATPase 1, chloroplastic OS=Ar... [more]
ACA1_ORYSJ3.032e-2840.98Calcium-transporting ATPase 1, plasma membrane-typ... [more]
ACA3_ORYSJ5.513e-2740.98Calcium-transporting ATPase 3, plasma membrane-typ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900170 VSS Citrus sinensis cDNA clone VS27V93 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900170 ID=DC900170|Name=DC900170|organism=Citrus sinensis|type=EST|length=793bp
TCTCACACCTTCAGAATCCTCAATTCAGCCNCAGTCATGTGCTGCTCTGT
CATCAATTTGGTGCTGCTGTTTCTCAGNAAAAGTCCCNCTAACTGCTGTT
CAGCTGCTCTGGGTGANCCTGATAATGNATCCCTGGNAGCATGGCATGGC
CACTGAGCAGCCCNCCAAAGATCTCATGTCAAAGCCTCCCGTGGCCCGAT
CCGAGCCCTCTGATACCAAACCTCATGTGNAGGAATCTCATCCCNTCAGN
CCATTNATCAGGTGCCCATCTTACTGACTCTGCAATTNAAAGNAAGATCA
ATCTTCGGCGTGCAGGAAAGTGCTAAAGATACCATGATTTTCAATACTTT
TGTCTTCTGCCAAATCTTCAATGAGTTCAATGCTAGGAAACTTGAGAAGA
AGAATATATTTAAAGGGATACACAAGAACAAGTTGTTTCTAGCAATCATT
GGAATTACCATTGTTCTTCAACTCATAATGGTAGAGTTTCTGAAGAAGTT
TGCTGATACTGAGAGGCTGAATTGGGGGCAATGGGCAGCTTGTATTGGCA
TTGCAGCTATGTCTTGGCCAATTGGTTTTCTCTTCAAGTGCATTCCCGTT
TCTGGCGAGCAGCTGCTTTTCAGGCAAAGAGCTCCATGAATCACAAATTC
ATAATCAATTCTCTATCAGTTAATATTGCCTTTTGTCTTTGTTTAGTTTC
ATAAGTTTCTTAGCTCAATTTGTAAATATAAGTCTAATAGCTAATTAGTT
CATAATGAAATTTATTTTGAACAAAAGAGAAAATTTTATTGCT
back to top