DC900166

Overview
NameDC900166
Unique NameDC900166
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length513
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1869 contig Csv1_Contig1869:24..535. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900166 vs. ExPASy Swiss-Prot
Match: SNAK2_SOLTU (Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.133e-28
Identity = 50/78 (64.10%), Postives = 61/78 (78.21%), Query Frame = 2
Query:  161 DQMVNTNEGDSSYPTPTIDCGAACKARCQLSSRPNLCHRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 394
            DQ+ +    +++Y    IDCG AC ARC+LSSRP LC+RACGTCCARC CVPPGTSG+ E CPCYA++TTH  +RKCP
Sbjct:   27 DQVTSNAISEAAYSYKKIDCGGACAARCRLSSRPRLCNRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP 104          
BLAST of DC900166 vs. ExPASy Swiss-Prot
Match: GASA1_ARATH (Gibberellin-regulated protein 1 OS=Arabidopsis thaliana GN=GASA1 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 9.060e-25
Identity = 45/61 (73.77%), Postives = 51/61 (83.61%), Query Frame = 2
Query:  212 IDCGAACKARCQLSSRPNLCHRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 394
            IDCG+AC ARC+LS RP LCHRACGTCC RC CVPPGT G+ + C CYA++TTH GRRKCP
Sbjct:   38 IDCGSACVARCRLSRRPRLCHRACGTCCYRCNCVPPGTYGNYDKCQCYASLTTHGGRRKCP 98          
BLAST of DC900166 vs. ExPASy Swiss-Prot
Match: GASA3_ARATH (Gibberellin-regulated protein 3 OS=Arabidopsis thaliana GN=GASA3 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 9.376e-22
Identity = 41/61 (67.21%), Postives = 47/61 (77.05%), Query Frame = 2
Query:  212 IDCGAACKARCQLSSRPNLCHRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 394
            IDCG  CK RC  SSRPNLC RAC +CC RC CVPPGT+G+  +CPCYA++TT  GR KCP
Sbjct:   39 IDCGGRCKGRCSKSSRPNLCLRACNSCCYRCNCVPPGTAGNHHLCPCYASITTRGGRLKCP 99          
BLAST of DC900166 vs. ExPASy Swiss-Prot
Match: GASA2_ARATH (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana GN=GASA2 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 9.376e-22
Identity = 41/61 (67.21%), Postives = 47/61 (77.05%), Query Frame = 2
Query:  212 IDCGAACKARCQLSSRPNLCHRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 394
            IDCG  CK RC  SSR  LC RAC +CC+RC CVPPGTSG+  +CPCYA++TTH GR KCP
Sbjct:   39 IDCGGRCKDRCSKSSRTKLCLRACNSCCSRCNCVPPGTSGNTHLCPCYASITTHGGRLKCP 99          
BLAST of DC900166 vs. ExPASy Swiss-Prot
Match: SNAK1_SOLTU (Snakin-1 OS=Solanum tuberosum GN=SN1 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.500e-11
Identity = 29/76 (38.16%), Postives = 38/76 (50.00%), Query Frame = 2
Query:  167 MVNTNEGDSSYPTPTIDCGAACKARCQLSSRPNLCHRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP 394
            ++ T    SS+      C + CK RC  +   + C + CG CC  CKCVP GT G+   CPCY       G+ KCP
Sbjct:   19 LIQTTMAGSSF------CDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP 88          
The following BLAST results are available for this feature:
BLAST of DC900166 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
SNAK2_SOLTU5.133e-2864.10Snakin-2 OS=Solanum tuberosum GN=SN2 PE=1 SV=1[more]
GASA1_ARATH9.060e-2573.77Gibberellin-regulated protein 1 OS=Arabidopsis tha... [more]
GASA3_ARATH9.376e-2267.21Gibberellin-regulated protein 3 OS=Arabidopsis tha... [more]
GASA2_ARATH9.376e-2267.21Gibberellin-regulated protein 2 OS=Arabidopsis tha... [more]
SNAK1_SOLTU1.500e-1138.16Snakin-1 OS=Solanum tuberosum GN=SN1 PE=1 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionDC900166 VSS Citrus sinensis cDNA clone VS27V85 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900166 ID=DC900166|Name=DC900166|organism=Citrus sinensis|type=EST|length=513bp
AAATTTAGGTTTTCAAATAGCTAGGTATCAGTTACTCCGATCAAAGCCCT
ACTTTCAATAGTTTCTAGCATTTAAGCTAGCCATGGCCATCTCGTCGTCC
AAGGCTTTCATTGCTTCAATTATCCTCTCACTTATTCTTGTTCTCCATCT
TGTTGCAGCTGATCAGATGGTTAACACAAACGAAGGAGATAGCAGTTATC
CCACTCCAACAATTGACTGTGGAGCTGCATGCAAGGCCAGGTGCCAGTTA
TCGTCGAGGCCAAACTTGTGTCACAGGGCATGTGGAACCTGCTGTGCCCG
TTGCAAGTGTGTTCCTCCGGGCACTTCAGGCCATCTTGAAGTCTGCCCTT
GCTACGCCACCATGACCACTCACCATGGCAGACGCAAGTGCCCTTAAAAC
AATGATTGTGCATGATACATGATACATGCACCTGTCCGTCGCTGCTTGTG
GCTACTGGCTAGTGATACATCTATTTATATATCATCAAATTAAATAAAGC
GATGTTAATTGCT
back to top