CN186087

Overview
NameCN186087
Unique NameCN186087
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length651
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig567 contig Csv1_Contig567:63..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186087 vs. ExPASy Swiss-Prot
Match: CYTI_VIGUN (Cysteine proteinase inhibitor OS=Vigna unguiculata PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 7.572e-24
Identity = 55/95 (57.89%), Postives = 68/95 (71.58%), Query Frame = -3
Query:  305 MATVGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXSGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKEFNTVAQS 589
            MA +GG R+V    N+ EI +LARFAV+EHNKKQN+ L+F           SGTLY ITLEA +GGQKK++EAKVWEKPW+ FKEL+EF  V  +
Sbjct:    1 MAALGGNRDVAGNQNSLEIDSLARFAVEEHNKKQNALLEFGRVVSAQQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKPWLNFKELQEFKHVGDA 95          
BLAST of CN186087 vs. ExPASy Swiss-Prot
Match: CYT6_ARATH (Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana GN=CYS6 PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 6.410e-23
Identity = 52/100 (52.00%), Postives = 70/100 (70.00%), Query Frame = -3
Query:  290 MATVGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXSGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKEFNTVAQSHSSTA 589
            MA VGGV +V A  N+ E+ +LARFAVDEHNKK+N+ L+F           +GTL+ +TLE +E GQKKL+EAKVW KPW+ FKEL+EF   + + + T+
Sbjct:   34 MALVGGVGDVPANQNSGEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKVWVKPWLNFKELQEFKPASDAPAITS 133          
BLAST of CN186087 vs. ExPASy Swiss-Prot
Match: CYT3_ARATH (Cysteine proteinase inhibitor 3 OS=Arabidopsis thaliana GN=CYS3 PE=2 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 3.889e-20
Identity = 49/93 (52.69%), Postives = 63/93 (67.74%), Query Frame = -3
Query:  323 TQKTMATVGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXSGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKEF 601
            T+KTM  +GGV ++    N+ EI +LARFA+ EHNK+QN  L+F           +GT+Y +TLEA EG Q K FEAKVW KPWM FK+L+EF
Sbjct:   29 TEKTMM-LGGVHDLRGNQNSGEIESLARFAIQEHNKQQNKILEFKKIVKAREQVVAGTMYHLTLEAKEGDQTKNFEAKVWVKPWMNFKQLQEF 120          
BLAST of CN186087 vs. ExPASy Swiss-Prot
Match: CYT12_ORYSJ (Cysteine proteinase inhibitor 12 OS=Oryza sativa subsp. japonica GN=Os01g0270100 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.131e-19
Identity = 48/110 (43.64%), Postives = 69/110 (62.73%), Query Frame = -3
Query:  293 FIIRLTQKTMA--TVGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXSGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKEFNTVAQSHSST 616
            F++      MA   +GG  +  + AN+ E   LARFAVDEHNK++N+ L+F           +GTL+ +TLEA+E G+KK++EAKVW KPW+ FKEL+EF     + + T
Sbjct:   34 FLVGSASLAMAGHVLGGAHDAPSAANSVETDALARFAVDEHNKRENALLEFVRVVEAKEQVVAGTLHHLTLEALEAGRKKVYEAKVWVKPWLDFKELQEFRNTGDATTFT 143          
BLAST of CN186087 vs. ExPASy Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 5.615e-19
Identity = 50/92 (54.35%), Postives = 59/92 (64.13%), Query Frame = -3
Query:  305 VGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXSGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKEFNTVAQS 580
            +GGV  V    N+  +V+LARFAV EHNKK NS L+F           +GTLY  T+E  EG  KKL+EAKVWEKPWM FKEL+EF  V  S
Sbjct:   47 LGGVEPV-GNENDLHLVDLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPVDAS 137          
BLAST of CN186087 vs. ExPASy Swiss-Prot
Match: CYT1_MAIZE (Cystatin-1 OS=Zea mays GN=RAMDAZC7 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.754e-18
Identity = 43/94 (45.74%), Postives = 62/94 (65.96%), Query Frame = -3
Query:  296 GGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXSGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKEFNTVAQSHSS 577
            GG+++V A  N+ ++  LARFAV+EHN+K N+ L F           +GT+Y +T+E  +G  KKL+EAKVWEKPW  FK+L+EF  V +  S+
Sbjct:   42 GGIKDVPANENDLQLQELARFAVNEHNQKANALLGFEKLVKAKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKPWENFKQLQEFKPVEEGASA 135          
BLAST of CN186087 vs. ExPASy Swiss-Prot
Match: CYTA_HELAN (Cysteine proteinase inhibitor A OS=Helianthus annuus PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.864e-17
Identity = 44/75 (58.67%), Postives = 50/75 (66.67%), Query Frame = -3
Query:  314 EIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXSGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKEFNTV 538
            EI  LARFAVDEHNKKQN+ L+F           +G +Y ITLEA  GG KK +EAKVW KPW  FKEL+EF  V
Sbjct:    3 EIDELARFAVDEHNKKQNALLEFGKVVNTKEQVVAGKMYYITLEATNGGVKKTYEAKVWVKPWENFKELQEFKPV 77          
BLAST of CN186087 vs. ExPASy Swiss-Prot
Match: CYT1_ARATH (Cysteine proteinase inhibitor 1 OS=Arabidopsis thaliana GN=CYS1 PE=1 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 2.608e-16
Identity = 39/93 (41.94%), Postives = 60/93 (64.52%), Query Frame = -3
Query:  320 QKTMATVGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXSGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKEFN 598
            Q+    VGGVR+++A AN+ ++ +LARFAVDEHNK +N  L++           +GT++ +T+E  +G   K++EAKV EK W   K+L+ FN
Sbjct:    4 QQAGTIVGGVRDIDANANDLQVESLARFAVDEHNKNENLTLEYKRLLGAKTQVVAGTMHHLTVEVADGETNKVYEAKVLEKAWENLKQLESFN 96          
BLAST of CN186087 vs. ExPASy Swiss-Prot
Match: CYT1_HORVU (Cysteine proteinase inhibitor OS=Hordeum vulgare GN=ICY PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.767e-15
Identity = 42/91 (46.15%), Postives = 55/91 (60.44%), Query Frame = -3
Query:  311 VGGVREVEATANNQ-EIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXSGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKEFNTVA 580
            +GGV++  A   N  E + LARFAV EHN K N+ L+F           +G ++  T+E  EGG KKL+EAKVWEK W  FK+L+EF   A
Sbjct:   17 LGGVQDAPAGRENDLETIELARFAVAEHNAKANALLEFEKLVKVRQQVVAGCMHYFTIEVKEGGAKKLYEAKVWEKAWENFKQLQEFKPAA 107          
BLAST of CN186087 vs. ExPASy Swiss-Prot
Match: CYT7_ARATH (Cysteine proteinase inhibitor 7 OS=Arabidopsis thaliana GN=CYS7 PE=2 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 4.919e-15
Identity = 36/79 (45.57%), Postives = 53/79 (67.09%), Query Frame = -3
Query:  305 QEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXSGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKEFNTVAQS 541
            +EI ++A FAV EHN+++N+ L+            +G LY +TLE +E G+KK++EAKVW KPWM FK+L+EF  +  S
Sbjct:   59 KEIDDIALFAVQEHNRRENAVLELARVLKATEQVVAGKLYRLTLEVIEAGEKKIYEAKVWVKPWMNFKQLQEFKNIIPS 137          
The following BLAST results are available for this feature:
BLAST of CN186087 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
CYTI_VIGUN7.572e-2457.89Cysteine proteinase inhibitor OS=Vigna unguiculata... [more]
CYT6_ARATH6.410e-2352.00Cysteine proteinase inhibitor 6 OS=Arabidopsis tha... [more]
CYT3_ARATH3.889e-2052.69Cysteine proteinase inhibitor 3 OS=Arabidopsis tha... [more]
CYT12_ORYSJ1.131e-1943.64Cysteine proteinase inhibitor 12 OS=Oryza sativa s... [more]
CYT1_ORYSJ5.615e-1954.35Cysteine proteinase inhibitor 1 OS=Oryza sativa su... [more]
CYT1_MAIZE4.754e-1845.74Cystatin-1 OS=Zea mays GN=RAMDAZC7 PE=2 SV=1[more]
CYTA_HELAN6.864e-1758.67Cysteine proteinase inhibitor A OS=Helianthus annu... [more]
CYT1_ARATH2.608e-1641.94Cysteine proteinase inhibitor 1 OS=Arabidopsis tha... [more]
CYT1_HORVU3.767e-1546.15Cysteine proteinase inhibitor OS=Hordeum vulgare G... [more]
CYT7_ARATH4.919e-1545.57Cysteine proteinase inhibitor 7 OS=Arabidopsis tha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002F13_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002F13, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186087 ID=CN186087|Name=CN186087|organism=Citrus sinensis|type=EST|length=651bp
TTTTTTTTTTTTTTTTTAAGTAGAAAGAGATTAATCTTGTATATATACTA
TTGACCAAAGGTCATTTCAATTATTTTTCACACAGTTATAAAAGTTGCGC
TGAGTTGCAGCTACTACCATAAATAATCGACACATAACTTGCAAAAGATT
AAAGAACCAAACTCATAAATCCGGTTACATTTATTTTTATATTCTGAACA
TGGTTATAGCTCCATTCTTATTGATACTGTCTCTTTGTTTGATCCATTGC
AAGCTACACGTAGATGTCATCTTCAGTCACCACAAGCTAAGCGGTTGAGG
AGTGAGACTGAGCCACAGTATTGAATTCTTTCAACTCCTTGAATTGCATC
CAAGGCTTCTCCCAGACCTTAGCTTCAAAAAGTTTCTTCTGACCTCCTTC
AACAGCCTCCAAGGTGATGTCGTACAGAGTCCCTGAAACCACTTGCTGCT
TCGCACTTACAACTTTTACAAATTGCAGATTTGAATTCTGCTTCTTGTTA
TGCTCATCCACAGCGAAGCGTGCGAGATTAACGATCTCCTGATTGTTGGC
TGTTGCTTCAACCTCACGAACACCGCCTACTGTAGCCATTGTTTTCTGCG
TAAGTCTGATGATAAAGCGATGAGAAAGATTTTAAGTTGTTGTGTTTTCC
T
back to top