CN186084

Overview
NameCN186084
Unique NameCN186084
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length718
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9803 contig Csv1_Contig9803:46..763. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186084 vs. ExPASy Swiss-Prot
Match: PRS8A_ARATH (26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=2 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.408e-101
Identity = 189/220 (85.91%), Postives = 201/220 (91.36%), Query Frame = 1
Query:   61 MAAVGIETKQPESAAPEEVCAAKGAS-KQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 717
            MAAVG+++++PE+A  EE C  KGA+ KQGEGL+QYYLQHIHELQ Q+RQKT+NLNRLEAQRNELNSRVRML+EELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVV            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT
Sbjct:    1 MAAVGVDSRRPETAM-EETCNVKGAAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 219          
BLAST of CN186084 vs. ExPASy Swiss-Prot
Match: PRS8B_ARATH (26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=2 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 6.121e-97
Identity = 183/220 (83.18%), Postives = 194/220 (88.18%), Query Frame = 1
Query:   61 MAAVGIETKQPESAAPEEVCAAKGAS-KQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 717
            MAAVG+E + P +A  EE C  KGA+ KQGEGL +YYLQH+ ELQ   R+K++NLNRLEAQRNELNSRVRML+EELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVV            PSTRVALRNDSYVLHL+LPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT
Sbjct:    1 MAAVGVEARPPVTAM-EETCNVKGAAAKQGEGLNKYYLQHLDELQRLQREKSYNLNRLEAQRNELNSRVRMLREELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKLTPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 219          
BLAST of CN186084 vs. ExPASy Swiss-Prot
Match: PRS8_RAT (26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.584e-79
Identity = 151/204 (74.02%), Postives = 169/204 (82.84%), Query Frame = 1
Query:  106 PEEVCAAKGASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 717
            PE++   +G  K G GLRQYYL  I ELQL V  K+ NL RL+AQRNELN++VR+L+EELQLLQE GSYVGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPELFE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHT
Sbjct:    6 PEQMELEEG--KAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT 207          
BLAST of CN186084 vs. ExPASy Swiss-Prot
Match: PRS8_PIG (26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.584e-79
Identity = 151/204 (74.02%), Postives = 169/204 (82.84%), Query Frame = 1
Query:  106 PEEVCAAKGASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 717
            PE++   +G  K G GLRQYYL  I ELQL V  K+ NL RL+AQRNELN++VR+L+EELQLLQE GSYVGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPELFE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHT
Sbjct:    6 PEQMELEEG--KAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT 207          
BLAST of CN186084 vs. ExPASy Swiss-Prot
Match: PRS8_MOUSE (26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.584e-79
Identity = 151/204 (74.02%), Postives = 169/204 (82.84%), Query Frame = 1
Query:  106 PEEVCAAKGASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 717
            PE++   +G  K G GLRQYYL  I ELQL V  K+ NL RL+AQRNELN++VR+L+EELQLLQE GSYVGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPELFE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHT
Sbjct:    6 PEQMELEEG--KAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT 207          
BLAST of CN186084 vs. ExPASy Swiss-Prot
Match: PRS8_HUMAN (26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.584e-79
Identity = 151/204 (74.02%), Postives = 169/204 (82.84%), Query Frame = 1
Query:  106 PEEVCAAKGASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 717
            PE++   +G  K G GLRQYYL  I ELQL V  K+ NL RL+AQRNELN++VR+L+EELQLLQE GSYVGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPELFE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHT
Sbjct:    6 PEQMELEEG--KAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT 207          
BLAST of CN186084 vs. ExPASy Swiss-Prot
Match: PRS8_BOVIN (26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.584e-79
Identity = 151/204 (74.02%), Postives = 169/204 (82.84%), Query Frame = 1
Query:  106 PEEVCAAKGASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 717
            PE++   +G  K G GLRQYYL  I ELQL V  K+ NL RL+AQRNELN++VR+L+EELQLLQE GSYVGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPELFE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHT
Sbjct:    6 PEQMELEEG--KAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT 207          
BLAST of CN186084 vs. ExPASy Swiss-Prot
Match: PRS8_DROME (26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Pros45 PE=1 SV=2)

HSP 1 Score: 291.197 bits (744), Expect = 3.731e-78
Identity = 146/197 (74.11%), Postives = 165/197 (83.76%), Query Frame = 1
Query:  127 KGASKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 717
            + A  +GEG R YY+Q I ELQL V +K  NL RL+AQRNELN++VRML+EELQLLQE GSYVGEVVK M K KVLVKVHPEGK+VV            P+ RVALRN+SY LH ILP+KVDPLV+LM VEKVPDSTY+M+GGLD+QIKEIKEVIELP+KHPELF++LGIAQPKGVLLYGPPGTGKTLLARAVAHHT
Sbjct:   10 ESAYHKGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHT 206          
BLAST of CN186084 vs. ExPASy Swiss-Prot
Match: PRS8_XENLA (26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2)

HSP 1 Score: 290.041 bits (741), Expect = 8.311e-78
Identity = 146/194 (75.26%), Postives = 163/194 (84.02%), Query Frame = 1
Query:  136 SKQGEGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 717
            S+ G GLRQYYL  I +LQL V  K+ NL RL+AQRNELN++VR+L+EELQLLQE GSYVGEVV+ M K KVLVKVHPEGK+VV            P+ RVALRNDSY LH ILP+KVDPLV+LM VEKVPDSTY+MIGGLD+QIKEIKEVIELP+KHPE FE+LGIAQPKGVLLYGPPGTGKTLLARAVAHHT
Sbjct:    9 SRGGTGLRQYYLSKIEDLQLVVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPEHFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHT 202          
BLAST of CN186084 vs. ExPASy Swiss-Prot
Match: PRS8_DICDI (26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2)

HSP 1 Score: 287.345 bits (734), Expect = 5.387e-77
Identity = 141/190 (74.21%), Postives = 163/190 (85.79%), Query Frame = 1
Query:  148 EGLRQYYLQHIHELQLQVRQKTHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKNKVLVKVHPEGKYVVXXXXXXXXXXXXPSTRVALRNDSYVLHLILPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 717
            +G++ YY   I EL+++V +K  +L RLEAQRNELN+RVRMLKEELQLL  PGS+V EVVK+MGKNKVLVKV+PEGK+VV            PSTR AL+++SY LH ILP+K+DPLV+LMKVEK+PDSTYDM+GGLD+QIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT
Sbjct:   14 KGIKSYYCSKIEELEIKVNEKAQDLRRLEAQRNELNNRVRMLKEELQLLTNPGSHVAEVVKLMGKNKVLVKVNPEGKFVVDIDPTVDIAKLTPSTRAALKHESYTLHRILPNKIDPLVSLMKVEKIPDSTYDMVGGLDKQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHT 203          
The following BLAST results are available for this feature:
BLAST of CN186084 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 183
Match NameE-valueIdentityDescription
PRS8A_ARATH1.408e-10185.9126S protease regulatory subunit 8 homolog A OS=Ara... [more]
PRS8B_ARATH6.121e-9783.1826S protease regulatory subunit 8 homolog B OS=Ara... [more]
PRS8_RAT2.584e-7974.0226S protease regulatory subunit 8 OS=Rattus norveg... [more]
PRS8_PIG2.584e-7974.0226S protease regulatory subunit 8 OS=Sus scrofa GN... [more]
PRS8_MOUSE2.584e-7974.0226S protease regulatory subunit 8 OS=Mus musculus ... [more]
PRS8_HUMAN2.584e-7974.0226S protease regulatory subunit 8 OS=Homo sapiens ... [more]
PRS8_BOVIN2.584e-7974.0226S protease regulatory subunit 8 OS=Bos taurus GN... [more]
PRS8_DROME3.731e-7874.1126S protease regulatory subunit 8 OS=Drosophila me... [more]
PRS8_XENLA8.311e-7875.2626S protease regulatory subunit 8 OS=Xenopus laevi... [more]
PRS8_DICDI5.387e-7774.2126S protease regulatory subunit 8 OS=Dictyostelium... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002F11_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002F11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186084 ID=CN186084|Name=CN186084|organism=Citrus sinensis|type=EST|length=718bp
GGAGACTTGATCCCAAAGACAATTAGATTCGAACAAATCGAACTCGTTCA
CTCGGAAAGAATGGCCGCTGTAGGAATCGAAACGAAGCAGCCGGAATCGG
CGGCGCCAGAGGAGGTGTGTGCGGCGAAAGGAGCATCGAAACAAGGAGAG
GGATTGAGGCAATACTACCTCCAACACATTCACGAACTCCAGCTCCAAGT
CCGTCAAAAAACCCACAATCTCAATCGCCTCGAAGCCCAGCGTAACGAAC
TCAATTCTAGAGTGCGGATGCTTAAAGAAGAATTACAGCTTCTTCAAGAG
CCTGGATCCTATGTCGGTGAAGTTGTTAAAGTTATGGGAAAAAATAAGGT
TCTTGTTAAGGTTCATCCTGAGGGGAAATATGTTGTTGATATTGATAAAA
GTATTGATATAACCAAGATCACTCCGTCAACAAGAGTTGCACTTCGTAAT
GACAGCTATGTTCTTCATTTGATCCTGCCAAGCAAAGTAGATCCCCTGGT
CAACCTTATGAAGGTTGAAAAGGTCCCTGATTCTACATATGACATGATTG
GTGGCCTTGATCAGCAAATTAAGGAGATCAAGGAGGTCATTGAGCTTCCT
ATCAAACATCCCGAATTGTTCGAGTCTCTTGGAATAGCTCAACCCAAGGG
TGTATTGCTATATGGACCACCTGGTACTGGCAAAACACTGTTGGCTAGAG
CTGTGGCTCATCATACTG
back to top