DC900121

Overview
NameDC900121
Unique NameDC900121
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length740
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9095 contig Csv1_Contig9095:77..816. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900121 vs. ExPASy Swiss-Prot
Match: ENO_RICCO (Enolase OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.304e-86
Identity = 159/170 (93.53%), Postives = 164/170 (96.47%), Query Frame = -1
Query:  219 SPKISXNALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 728
            S KIS  ALKDLYKSF S+YPIVSIEDPFDQDDWEHY+KLTSE+GEKVQIVGDDLLVTNPKRVEKAI+EK CNALLLKVNQIGSVTESIEAVRMSK+AGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFR PVEPY
Sbjct:  276 SQKISGEALKDLYKSFASEYPIVSIEDPFDQDDWEHYSKLTSEIGEKVQIVGDDLLVTNPKRVEKAIQEKACNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRTPVEPY 445          
BLAST of DC900121 vs. ExPASy Swiss-Prot
Match: ENO2_HEVBR (Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 3.327e-85
Identity = 156/170 (91.76%), Postives = 163/170 (95.88%), Query Frame = -1
Query:  219 SPKISXNALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 728
            S KIS + LKDLYKSF+++YPIVSIEDPFDQDDWEHYAKLTSE+G KVQIVGDDLLVTNPKRVEKAIKEK CNALLLKVNQIGSVTESIEAV+MSK+AGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGA FR PVEPY
Sbjct:  276 SQKISGDVLKDLYKSFVTEYPIVSIEDPFDQDDWEHYAKLTSEIGVKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY 445          
BLAST of DC900121 vs. ExPASy Swiss-Prot
Match: ENO1_HEVBR (Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 3.327e-85
Identity = 156/170 (91.76%), Postives = 163/170 (95.88%), Query Frame = -1
Query:  219 SPKISXNALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 728
            S KIS  ALKDLYKSF+++YPIVSIEDPFDQDDW HYAKLTSE+GEKVQIVGDDLLVTNPKRVEKAIKEK CNALLLKVNQIGSVTESIEAV+MSK+AGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+EAVYAGA FR PVEPY
Sbjct:  276 SQKISGEALKDLYKSFVAEYPIVSIEDPFDQDDWAHYAKLTSEIGEKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY 445          
BLAST of DC900121 vs. ExPASy Swiss-Prot
Match: ENO_ALNGL (Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 6.938e-83
Identity = 153/170 (90.00%), Postives = 162/170 (95.29%), Query Frame = -1
Query:  219 SPKISXNALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 728
            S KIS + LKDLYKSF+ +YPIVSIEDPFDQDDWEHY+KLT+E+GEKVQIVGDDLLVTNPKRVEKAIKEK CNALLLKVNQIGSVTESIEAV+MSK+AGWGVMA HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+EAVYAGA FR PVEPY
Sbjct:  272 SQKISADQLKDLYKSFVDEYPIVSIEDPFDQDDWEHYSKLTAEIGEKVQIVGDDLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMA-HRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRTPVEPY 440          
BLAST of DC900121 vs. ExPASy Swiss-Prot
Match: ENO_ORYSJ (Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE=1 SV=2)

HSP 1 Score: 305.064 bits (780), Expect = 2.636e-82
Identity = 149/170 (87.65%), Postives = 164/170 (96.47%), Query Frame = -1
Query:  219 SPKISXNALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 728
            S KIS ++LK++YKSF+S+YPIVSIEDPFDQDDWEHYAK+T+E+GE+VQIVGDDLLVTNP RV KAI+EK+CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETEDTFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGA AVYAGAKFRAPVEPY
Sbjct:  277 SQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGDDLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETEDTFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY 446          
BLAST of DC900121 vs. ExPASy Swiss-Prot
Match: ENO_SOLLC (Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 7.671e-82
Identity = 150/170 (88.24%), Postives = 161/170 (94.71%), Query Frame = -1
Query:  219 SPKISXNALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 728
            S KIS + LKDLYKSF+S+YPIVSIEDPFDQDDWE YAKLT+E+GE+VQIVGDDLLVTNPKRV KAI EKTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETEDTFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+EAVYAGA FR PVEPY
Sbjct:  275 SQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTAEIGEQVQIVGDDLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGASFRKPVEPY 444          
BLAST of DC900121 vs. ExPASy Swiss-Prot
Match: ENO_MESCR (Enolase OS=Mesembryanthemum crystallinum GN=PGH1 PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.709e-81
Identity = 149/170 (87.65%), Postives = 160/170 (94.12%), Query Frame = -1
Query:  219 SPKISXNALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 728
            S +IS  ALKDLYKSF+++YPIVSIEDPFDQDDWEHYAK+T+E GEKVQIVGDDLLVTNPKRV+KAI E  CNALLLKVNQIGSVTESIEAV+MSK+AGWGVMASHRSGETEDTFIADLSVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG +AVYAGA FR PVEPY
Sbjct:  275 SQRISGEALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTAECGEKVQIVGDDLLVTNPKRVKKAIDENPCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMASHRSGETEDTFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDKAVYAGANFRRPVEPY 444          
BLAST of DC900121 vs. ExPASy Swiss-Prot
Match: ENO1_MAIZE (Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 2.232e-81
Identity = 151/170 (88.82%), Postives = 159/170 (93.53%), Query Frame = -1
Query:  219 SPKISXNALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 728
            S KIS ++LKDLYKSF+S+YPI SIEDPFDQDDW  YAKLT E+G+KVQIVGDDLLVTNP RV KAI EKTCNALLLKVNQIGSVTESIEAVRMSK+AGWGVMASHRSGETEDTFIADLSVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGAKFRAPVEPY
Sbjct:  277 SNKISGDSLKDLYKSFVSEYPIESIEDPFDQDDWSTYAKLTDEIGQKVQIVGDDLLVTNPTRVAKAINEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETEDTFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY 446          
BLAST of DC900121 vs. ExPASy Swiss-Prot
Match: ENO2_MAIZE (Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.915e-81
Identity = 148/170 (87.06%), Postives = 162/170 (95.29%), Query Frame = -1
Query:  219 SPKISXNALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 728
            S KIS ++LK++YKSF+S+YPIVSIEDPFDQDDW HYAK+T E+GE+VQIVGDDLLVTNP RV KAIKEK+CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETEDTFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGA AVYAGAKFRAPVEPY
Sbjct:  277 SQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEEIGEQVQIVGDDLLVTNPTRVAKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETEDTFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAIAVYAGAKFRAPVEPY 446          
BLAST of DC900121 vs. ExPASy Swiss-Prot
Match: ENO_ARATH (Enolase OS=Arabidopsis thaliana GN=ENO PE=1 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 8.481e-81
Identity = 146/170 (85.88%), Postives = 160/170 (94.12%), Query Frame = -1
Query:  219 SPKISXNALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGDDLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY 728
            S KIS +ALKDLYKSF+++YPIVSIEDPFDQDDWEHYAK+T+E G +VQIVGDDLLVTNPKRV KAI EK+CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETEDTFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+EA+YAG  FR PVEPY
Sbjct:  275 SQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGTEVQIVGDDLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY 444          
The following BLAST results are available for this feature:
BLAST of DC900121 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
ENO_RICCO2.304e-8693.53Enolase OS=Ricinus communis PE=2 SV=1[more]
ENO2_HEVBR3.327e-8591.76Enolase 2 OS=Hevea brasiliensis GN=ENO2 PE=1 SV=1[more]
ENO1_HEVBR3.327e-8591.76Enolase 1 OS=Hevea brasiliensis GN=ENO1 PE=1 SV=1[more]
ENO_ALNGL6.938e-8390.00Enolase OS=Alnus glutinosa GN=PGH1 PE=2 SV=1[more]
ENO_ORYSJ2.636e-8287.65Enolase OS=Oryza sativa subsp. japonica GN=ENO1 PE... [more]
ENO_SOLLC7.671e-8288.24Enolase OS=Solanum lycopersicum GN=PGH1 PE=2 SV=1[more]
ENO_MESCR1.709e-8187.65Enolase OS=Mesembryanthemum crystallinum GN=PGH1 P... [more]
ENO1_MAIZE2.232e-8188.82Enolase 1 OS=Zea mays GN=ENO1 PE=2 SV=1[more]
ENO2_MAIZE2.915e-8187.06Enolase 2 OS=Zea mays GN=ENO2 PE=2 SV=1[more]
ENO_ARATH8.481e-8185.88Enolase OS=Arabidopsis thaliana GN=ENO PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900121 VSS Citrus sinensis cDNA clone VS27V36 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900121 ID=DC900121|Name=DC900121|organism=Citrus sinensis|type=EST|length=740bp
TTCAACTAGATACTCATTCTAATAAAACATGCTCTAGGAAATGGTTCCTC
ATACAGCAAGGTTCAAGCTCTCAGACAAAAACTGTGTCAAAATTATTGAG
GAAATATCTTGGGTCACAAAATGCTAAAAACCCATAAAAATCCATTTTAC
ATAACTTATTGAAGTAAACCTCCATTGCTCAAATCCAGCACCACACCAGA
TCAGCATCTCAAACTCTAGTAGGGTTCAACAGGGGCACGGAACTTGGCAC
CAGCATAAACTGCTTCAGCACCGAGCTCTTCTTCAATTCTCAGAAGCTGA
TTATACTTTGCAAGACGCTCTGACCTGCATGGTGCTCCTGTCTTAATTTG
ACCCGTGGCCAAGCCCACTGAGAGATCGGCAATGAAAGTATCTTCAGTCT
CACCACTGCGGTGGCTGGCCATCACACCCCACCCAGCTTGCTTGGACATT
CTGACGGCTTCAATGCTCTCAGTTACAGATCCAATTTGATTAACCTTGAG
AAGGAGGGCGTTGCAGGTCTTCTCTTTGATAGCCTTCTCAACCCTCTTAG
GATTGGTGACCAAAAGATCATCTCCAACAATTTGTACTTTTTCTCCAACC
TCACTGGTTAGCTTGGCATAGTGCTCCCAGTCGTCTTGGTCAAATGGATC
TTCAATTGATACAATAGGATAATCAGAGATGAATGACTTATAGAGATCTT
TGAGTGCATTTNCTGAGATCTTTGGGGACCATCATTGGTC
back to top