DC900118

Overview
NameDC900118
Unique NameDC900118
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1051
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig906 contig Csv1_Contig906:56..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900118 vs. ExPASy Swiss-Prot
Match: 6PGL4_ORYSI (Probable 6-phosphogluconolactonase 4, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_031067 PE=3 SV=2)

HSP 1 Score: 400.979 bits (1029), Expect = 6.074e-111
Identity = 195/270 (72.22%), Postives = 231/270 (85.56%), Query Frame = 3
Query:   99 SSDCVRIKASSSMAAENXXKNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQ-NSDLLPVQMALAEE-EFTWFLDKDATSKL 902
            ++DC     +++ AA    K K V +FD+EEDLAVSLAKYTA+LSAK   E+G+FTVVLSGGSLI ++RKL EPPY+DS++W+KWHVFWVDERVVPKDH+DSNYKLA DGFLS+VPI TG VYAINDALSAEGAA+DYETCLK L K+ ++A S +TGFP+FD+MLLGMGPDGHIASLFPGHPL+ EN+KWVT+IKDSPKPPPERITFTFPVINSSAY+AMVV GAGK+ AVQ AL + Q +SDLLPV+MA+ ++ EFTWF DK A S L
Sbjct:   57 ATDC-----AAAAAAAGSKKKKEVLIFDAEEDLAVSLAKYTAELSAKLAAERGAFTVVLSGGSLIKNIRKLAEPPYLDSVDWSKWHVFWVDERVVPKDHEDSNYKLALDGFLSKVPIPTGQVYAINDALSAEGAADDYETCLKQLVKNGVIAMSQSTGFPRFDVMLLGMGPDGHIASLFPGHPLVNENKKWVTYIKDSPKPPPERITFTFPVINSSAYVAMVVTGAGKAGAVQKALSDKQTSSDLLPVEMAVLQDGEFTWFTDKPAVSML 321          
BLAST of DC900118 vs. ExPASy Swiss-Prot
Match: 6PGL4_ORYSJ (Probable 6-phosphogluconolactonase 4, chloroplastic OS=Oryza sativa subsp. japonica GN=Os09g0529100 PE=2 SV=2)

HSP 1 Score: 400.593 bits (1028), Expect = 7.933e-111
Identity = 193/261 (73.95%), Postives = 227/261 (86.97%), Query Frame = 3
Query:  126 SSSMAAENXXKNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQ-NSDLLPVQMALAEE-EFTWFLDKDATSKL 902
            +++ AA    K K V +FD+EEDLAVSLAKYTA+LSAK   E+G+FTVVLSGGSLI ++RKL EPPY+DS++W+KWHVFWVDERVVPKDH+DSNYKLA DGFLS+VPI TG VYAINDALSAEGAA+DYETCLK L K+ ++A S +TGFP+FD+MLLGMGPDGHIASLFPGHPL+ EN+KWVT+IKDSPKPPPERITFTFPVINSSAY+AMVV GAGK+ AVQ AL + Q +SDLLPV+MA+ ++ EFTWF DK A S L
Sbjct:   61 AAAAAAAGSKKKKEVLIFDAEEDLAVSLAKYTAELSAKLAAERGAFTVVLSGGSLIKNIRKLAEPPYLDSVDWSKWHVFWVDERVVPKDHEDSNYKLALDGFLSKVPIPTGQVYAINDALSAEGAADDYETCLKQLVKNGVIAMSQSTGFPRFDVMLLGMGPDGHIASLFPGHPLVNENKKWVTYIKDSPKPPPERITFTFPVINSSAYVAMVVTGAGKAGAVQKALSDKQTSSDLLPVEMAVLQDGEFTWFTDKPAVSML 321          
BLAST of DC900118 vs. ExPASy Swiss-Prot
Match: 6PGL5_ARATH (Probable 6-phosphogluconolactonase 5, chloroplastic OS=Arabidopsis thaliana GN=EMB2024 PE=2 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 1.148e-101
Identity = 186/282 (65.96%), Postives = 218/282 (77.30%), Query Frame = 3
Query:   63 LQFRNISLDRNKSSDCVRIKASSSMAAENXXKN--KNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL 902
            L   +I     K S   R K  S MA  N  K   K V+++D EE+L + LAK+TADLS KF KE+G+FTVV+SGGSLI SLRKLVE PYVDSI+WA+WH FWVDERVVPK+HDDSNYKLAYD FLS+VPI  GNVYAIN+ALSAE AA+DYETCLKHL  +NIL  S +TGFPKFDLMLLGMGPDGH+ASLFPGH L  E++KWV  I DSPKPP ERITFTFPVINSSA++A+VVCG+GK+ AV+ AL   +  ++ P     AE+E  WFLDK A+SKL
Sbjct:   47 LSVSSIGTGSTKKSSDTRRKVKS-MATTNIGKEEKKRVEIYDLEENLVIDLAKFTADLSDKFCKERGAFTVVVSGGSLIKSLRKLVESPYVDSIDWARWHFFWVDERVVPKNHDDSNYKLAYDSFLSKVPIPPGNVYAINEALSAEAAADDYETCLKHLVNTNILRVSESTGFPKFDLMLLGMGPDGHVASLFPGHGLCNESKKWVVSISDSPKPPSERITFTFPVINSSAHVALVVCGSGKAEAVEAAL--KKTGNVPPAGSVSAEDELVWFLDKPASSKL 325          
BLAST of DC900118 vs. ExPASy Swiss-Prot
Match: 6PGL3_ORYSJ (Probable 6-phosphogluconolactonase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0547100 PE=2 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 1.151e-93
Identity = 167/249 (67.07%), Postives = 199/249 (79.92%), Query Frame = 3
Query:  162 KNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQ-NSDLLPVQMALAEE-EFTWFLDKDATSKL 902
            K + +FD+EE LA SLAKYTA LS +   E+G+FTV LSGGSLI +LRKL E PY++++EW+KWHVFWVDERVVPKDH DSNYKLA DG LS+VPI    +YAIND LSAEGAA++YETCLK L    ++A S  TGFPK DLMLLGMGPDGH+ASLFPGHP++ EN KWV++IKDSPKPPPERITFTFP++NSSA+IA+VV GAGK+ AV  A  + Q +SDLLPV+M   +E   TWF DK A S L
Sbjct:   76 KKLLIFDAEEYLAESLAKYTARLSGEAVAERGAFTVALSGGSLIKALRKLTESPYLEAVEWSKWHVFWVDERVVPKDHADSNYKLAMDGLLSKVPIPASQIYAINDTLSAEGAADEYETCLKQLVNDGVVAISEVTGFPKLDLMLLGMGPDGHVASLFPGHPVVNENLKWVSYIKDSPKPPPERITFTFPLVNSSAHIALVVTGAGKAGAVHKAFSDKQSSSDLLPVEMVSQQEGVLTWFTDKPAVSML 324          
BLAST of DC900118 vs. ExPASy Swiss-Prot
Match: 6PGL3_ORYSI (Probable 6-phosphogluconolactonase 3, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_30141 PE=3 SV=2)

HSP 1 Score: 343.584 bits (880), Expect = 1.151e-93
Identity = 167/249 (67.07%), Postives = 199/249 (79.92%), Query Frame = 3
Query:  162 KNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQ-NSDLLPVQMALAEE-EFTWFLDKDATSKL 902
            K + +FD+EE LA SLAKYTA LS +   E+G+FTV LSGGSLI +LRKL E PY++++EW+KWHVFWVDERVVPKDH DSNYKLA DG LS+VPI    +YAIND LSAEGAA++YETCLK L    ++A S  TGFPK DLMLLGMGPDGH+ASLFPGHP++ EN KWV++IKDSPKPPPERITFTFP++NSSA+IA+VV GAGK+ AV  A  + Q +SDLLPV+M   +E   TWF DK A S L
Sbjct:   76 KKLLIFDAEEYLAESLAKYTARLSGEAVAERGAFTVALSGGSLIKALRKLTESPYLEAVEWSKWHVFWVDERVVPKDHADSNYKLAMDGLLSKVPIPASQIYAINDTLSAEGAADEYETCLKQLVNDGVVAISEVTGFPKLDLMLLGMGPDGHVASLFPGHPVVNENLKWVSYIKDSPKPPPERITFTFPLVNSSAHIALVVTGAGKAGAVHKAFSDKQSSSDLLPVEMVSQQEGVLTWFTDKPAVSML 324          
BLAST of DC900118 vs. ExPASy Swiss-Prot
Match: 6PGL2_ARATH (Probable 6-phosphogluconolactonase 2 OS=Arabidopsis thaliana GN=At3g49360 PE=2 SV=2)

HSP 1 Score: 291.967 bits (746), Expect = 3.974e-78
Identity = 146/248 (58.87%), Postives = 178/248 (71.77%), Query Frame = 3
Query:  171 QVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEG----AAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL 902
            +VF +  ++AV LAKYTADLS+KF KE+G FTVVLSGG LI  L KL+E PY+DSIEW+KWH+FWVDERV   DH DSNYKLAYDGFLS+VP+   N+YAI++ L AEG    AAE YE CLK     NI+ T  ++GFP+FDL LLGMGPDGH+ASLFPGH  + E  KWVT I DSPKPP +RIT T PVIN ++Y  M VC   ++ +V  AL + ++   LP     A+ E  WFLD+ A SKL
Sbjct:    7 RVFKTNNEMAVELAKYTADLSSKFCKERGVFTVVLSGGDLIAWLWKLLEAPYIDSIEWSKWHIFWVDERVCAWDHADSNYKLAYDGFLSKVPVPAENIYAIDNGLGAEGNAELAAERYEECLKQKVNQNIIRTYKSSGFPQFDLQLLGMGPDGHMASLFPGHAQINEKVKWVTSITDSPKPPSKRITLTLPVINCASYNVMAVCDKEQADSVAAALNHTKD---LPAGRLTADVEVVWFLDQAAASKL 251          
BLAST of DC900118 vs. ExPASy Swiss-Prot
Match: 6PGL3_ARATH (Probable 6-phosphogluconolactonase 3 OS=Arabidopsis thaliana GN=At5g24420 PE=2 SV=2)

HSP 1 Score: 285.419 bits (729), Expect = 3.719e-76
Identity = 143/247 (57.89%), Postives = 179/247 (72.47%), Query Frame = 3
Query:  174 VFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAED----YETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL 902
            VF ++ +L+ ++A+YTA+LSAKF KEKG FTVVLSGG LID L KLV+PPY+DSIEW KWHVFWVDERV   +  DSNYKLA +GFLS+VPI   N+YAI+  L+A+G AE     YE CLK+L K  I+  S  TG+P+FDL LLGMGPDGH+ASLFP HP + E +KWVT+I DSPKPPP+RITFT PVINS+ Y  M +C    + +V   + +N  S  LP     A+ E  W+LD+ A S+L
Sbjct:    8 VFPTKNELSEAMAEYTANLSAKFIKEKGLFTVVLSGGDLIDWLCKLVQPPYIDSIEWPKWHVFWVDERVCAWEDPDSNYKLAMEGFLSKVPIPDKNIYAIDKHLAADGNAEHCATLYEECLKNLVKEKIIPISKKTGYPEFDLQLLGMGPDGHMASLFPNHPQINEKQKWVTYITDSPKPPPKRITFTLPVINSTLYNLMAICDKAPAKSVAEIMKHNNLS--LPSAHLSAQVENVWYLDQAAASEL 252          
BLAST of DC900118 vs. ExPASy Swiss-Prot
Match: 6PGL4_ARATH (Probable 6-phosphogluconolactonase 4 OS=Arabidopsis thaliana GN=At5g24410 PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.563e-74
Identity = 141/253 (55.73%), Postives = 181/253 (71.54%), Query Frame = 3
Query:  156 KNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAED----YETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNSDLLPVQMALAEEEFTWFLDKDATSKL 902
            K+K + VF ++++L+ ++A YTA+LSAKF KE+G FTVVLSGG LI  L +L+EP Y +SIEW+KWH+FWVDERVVP DH+DSNYKLA+DGFLS+VPI   N+Y I+   +A G A+     YE CLK L   NI+ T  ++GFP+FDL LLGMGPDGH+ASLFPGH  +KE    VT+I DSPKPPP+RITFT PVIN ++Y  M VC   ++ AV     +N +   LP     A+ E  WFLD+ A SK+
Sbjct:    9 KSKKI-VFPTKKELSEAMATYTANLSAKFCKERGYFTVVLSGGDLISWLSELLEPKYQESIEWSKWHIFWVDERVVPLDHEDSNYKLAFDGFLSKVPIPIANIYPIDKDCAALGDAKSAALLYEECLKRLVNRNIIRTYKSSGFPQFDLQLLGMGPDGHMASLFPGHYQIKEKANLVTYITDSPKPPPKRITFTLPVINCASYNLMAVCDEAQADAVAKVFNHNFD---LPAAWLTADVEAIWFLDQAAASKI 257          
BLAST of DC900118 vs. ExPASy Swiss-Prot
Match: 6PGL2_ORYSJ (Probable 6-phosphogluconolactonase 2 OS=Oryza sativa subsp. japonica GN=Os07g0604000 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.326e-65
Identity = 119/254 (46.85%), Postives = 169/254 (66.54%), Query Frame = 3
Query:  156 KNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNS----DLLPVQMAL-AEEEFTWFLDKDATSKL 902
            +N  +++F+S ++++  LA+Y + +S    KE+G F + LSGG L+  L KL E PY  +++W+KW++FW DER V K+H +SNY++  +GFLS+VPI  G+VY+IND  + E AA DYE  ++ L K   +  S +   PKFDL+LL MG DGH+ASLFP HP L+  + W+T+I DSP+PPPERITFT PVINS++ IA+V  G  KS AV  A+ +N +       LP +M    + +  WFLDK A S L
Sbjct:   13 RNNEIRIFESSDEMSTDLAEYISQVSEISVKERGYFAIALSGGPLVSFLGKLCEAPYNKTLDWSKWYIFWSDERAVAKNHAESNYRITKEGFLSKVPILNGHVYSINDNATVEDAATDYEFVIRQLVKVRTIGVSESNDCPKFDLILLSMGSDGHVASLFPNHPSLELKDDWITYITDSPQPPPERITFTLPVINSASNIAIVTTGDDKSEAVHLAISDNADGPEAPSSLPARMVQPTDGKLVWFLDKSAASSL 266          
BLAST of DC900118 vs. ExPASy Swiss-Prot
Match: 6PGL2_ORYSI (Probable 6-phosphogluconolactonase 2 OS=Oryza sativa subsp. indica GN=OsI_025867 PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.326e-65
Identity = 119/254 (46.85%), Postives = 169/254 (66.54%), Query Frame = 3
Query:  156 KNKNVQVFDSEEDLAVSLAKYTADLSAKFGKEKGSFTVVLSGGSLIDSLRKLVEPPYVDSIEWAKWHVFWVDERVVPKDHDDSNYKLAYDGFLSQVPITTGNVYAINDALSAEGAAEDYETCLKHLTKSNILATSAATGFPKFDLMLLGMGPDGHIASLFPGHPLLKENEKWVTFIKDSPKPPPERITFTFPVINSSAYIAMVVCGAGKSSAVQTALGNNQNS----DLLPVQMAL-AEEEFTWFLDKDATSKL 902
            +N  +++F+S ++++  LA+Y + +S    KE+G F + LSGG L+  L KL E PY  +++W+KW++FW DER V K+H +SNY++  +GFLS+VPI  G+VY+IND  + E AA DYE  ++ L K   +  S +   PKFDL+LL MG DGH+ASLFP HP L+  + W+T+I DSP+PPPERITFT PVINS++ IA+V  G  KS AV  A+ +N +       LP +M    + +  WFLDK A S L
Sbjct:   13 RNNEIRIFESSDEMSTDLAEYISQVSEISVKERGYFAIALSGGPLVSFLGKLCEAPYNKTLDWSKWYIFWSDERAVAKNHAESNYRITKEGFLSKVPILNGHVYSINDNATVEDAATDYEFVIRQLVKVRTIGVSESNDCPKFDLILLSMGSDGHVASLFPNHPSLELKDDWITYITDSPQPPPERITFTLPVINSASNIAIVTTGDDKSEAVHLAISDNADGPEAPSSLPARMVQPTDGKLVWFLDKSAASSL 266          
The following BLAST results are available for this feature:
BLAST of DC900118 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
6PGL4_ORYSI6.074e-11172.22Probable 6-phosphogluconolactonase 4, chloroplasti... [more]
6PGL4_ORYSJ7.933e-11173.95Probable 6-phosphogluconolactonase 4, chloroplasti... [more]
6PGL5_ARATH1.148e-10165.96Probable 6-phosphogluconolactonase 5, chloroplasti... [more]
6PGL3_ORYSJ1.151e-9367.07Probable 6-phosphogluconolactonase 3, chloroplasti... [more]
6PGL3_ORYSI1.151e-9367.07Probable 6-phosphogluconolactonase 3, chloroplasti... [more]
6PGL2_ARATH3.974e-7858.87Probable 6-phosphogluconolactonase 2 OS=Arabidopsi... [more]
6PGL3_ARATH3.719e-7657.89Probable 6-phosphogluconolactonase 3 OS=Arabidopsi... [more]
6PGL4_ARATH1.563e-7455.73Probable 6-phosphogluconolactonase 4 OS=Arabidopsi... [more]
6PGL2_ORYSJ1.326e-6546.85Probable 6-phosphogluconolactonase 2 OS=Oryza sati... [more]
6PGL2_ORYSI1.326e-6546.85Probable 6-phosphogluconolactonase 2 OS=Oryza sati... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900118 VSS Citrus sinensis cDNA clone VS27V33 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900118 ID=DC900118|Name=DC900118|organism=Citrus sinensis|type=EST|length=1051bp
CTCGTGCCGCATTCGGCACGAGTCAGTTTCAGTTTCAGTTACTCAGAAGA
CCAAACTCACTCCTCCAATTTCGAAACATTTCCCTTGATCGGAACAAATC
ATCGGACTGCGTGAGAATCAAGGCATCATCATCAATGGCTGCCGAGAATA
ANANCAAGAACAAGAACGTACAAGTTTTTGACTCAGAGGAAGATCTGGCT
GTGTCTTTGGCCAAATACACCGCCGATCTATCTGCCAAGTTCGGTAAAGA
GAAGGGCTCCTTCACTGTCGTCTTATCCGGTGGTTCTCTCATCGACTCCC
TCAGGAAATTAGTGGAACCCCCGTATGTAGATTCAATTGAATGGGCGAAA
TGGCATGTGTTTTGGGTTGATGAAAGAGTTGTTCCCAAGGATCATGATGA
TAGCAATTATAAGCTTGCTTATGATGGTTTCCTTTCTCAGGTACCAATTA
CCACTGGCAATGTCTATGCCATCAATGATGCATTATCTGCTGAAGGTGCA
GCTGAAGATTACGAGACTTGTCTCAAGCATTTGACAAAGAGCAATATATT
AGCTACATCTGCTGCTACTGGTTTTCCAAAGTTTGATCTCATGCTTCTGG
GTATGGGTCCAGATGGACATATAGCTTCTCTGTTTCCAGGGCATCCTCTT
CTCAAGGAGAATGAGAAATGGGTTACTTTCATTAAAGACTCGCCAAAGCC
ACCTCCAGAGAGAATCACTTTCACCTTCCCTGTAATCAACTCATCTGCAT
ATATTGCAATGGTGGTGTGTGGTGCTGGAAAATCAAGTGCAGTTCAAACT
GCATTGGGTAATAATCAAAACTCTGATTTGCTGCCAGTTCAAATGGCATT
GGCTGAAGAAGAATTCACTTGGTTTCTTGACAAAGACGCNACTTCAAAGC
TGTAAGAGTCAGAACAATTTGCTGTATGCATGAATCCCTGTTATCTGCTA
TGATAATTGGTTTGATCTGTGTGGTTTGACTACTAGTACTGCTGGATTTT
GTTAGTAATGAGAACAGAGTGAACTTGTTAATGGAAGTGAAAAAGATTTA
A
back to top