DC900116

Overview
NameDC900116
Unique NameDC900116
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1107
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3510 contig Csv1_Contig3510:263..1369. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_ARATH (Phosphoenolpyruvate carboxykinase [ATP] OS=Arabidopsis thaliana GN=PCKA PE=1 SV=1)

HSP 1 Score: 546.199 bits (1406), Expect = 1.265e-154
Identity = 260/312 (83.33%), Postives = 278/312 (89.10%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGPNF 937
            KDG VA               DHNRYLIGDDEHCW + GVSNIEGGCYAKC+DLSREKEPDIWNAIKFG VLENVVFDEHTREVDYSDKSVTENTRAAYPIE+IPNAKIPCVGPHP NVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKM+  GATGWLVNTGWSGGSYG G+RIKL YTRKIIDAIHSGSLL ANYKKT++FG EIPTE+EG+PSEILDP N+W+DK+A+K+TL+KL GLFK+NFE+F N+KIG D KLTEEIL  GP F
Sbjct:  360 KDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWTETGVSNIEGGCYAKCVDLSREKEPDIWNAIKFGTVLENVVFDEHTREVDYSDKSVTENTRAAYPIEFIPNAKIPCVGPHPTNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMKSQGATGWLVNTGWSGGSYGVGNRIKLAYTRKIIDAIHSGSLLKANYKKTEIFGFEIPTEIEGIPSEILDPVNSWSDKKAHKDTLVKLGGLFKKNFEVFANHKIGVDGKLTEEILAAGPIF 671          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA1_UROPA (Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Urochloa panicoides GN=PCK1 PE=1 SV=1)

HSP 1 Score: 544.658 bits (1402), Expect = 3.681e-154
Identity = 258/312 (82.69%), Postives = 275/312 (88.14%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGPNF 937
            K+G VA               DHNR LIGDDEHCW DNGVSNIEGGCYAKCIDLS+EKEPDIWNAI FG VLENVVF+E TREVDY+DKS+TENTRAAYPIE+IPNAKIPCVGPHPKNVILLACDA+GVLPPVSKLNLAQTMYHFISGYTA+VAGTEDG+KEPTATFSACFGAAFIM HPTKYAAMLAEKMQK+G TGWLVNTGWSGG YG G+RIKLPYTRKIIDAIHSG LL ANYKKT+VFG+EIPTE+ GVPSEILDP NTW DK AYKETLLKLAGLFK NFE+F +YKIG DN LTE+IL  GPNF
Sbjct:  313 KEGDVALFFGLSGTGKTTLSTDHNRLLIGDDEHCWSDNGVSNIEGGCYAKCIDLSKEKEPDIWNAITFGTVLENVVFNERTREVDYADKSITENTRAAYPIEFIPNAKIPCVGPHPKNVILLACDAYGVLPPVSKLNLAQTMYHFISGYTAIVAGTEDGVKEPTATFSACFGAAFIMYHPTKYAAMLAEKMQKYGRTGWLVNTGWSGGRYGVGNRIKLPYTRKIIDAIHSGELLTANYKKTEVFGLEIPTEINGVPSEILDPVNTWTDKAAYKETLLKLAGLFKNNFEVFASYKIGDDNSLTEQILAAGPNF 624          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA2_UROPA (Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Urochloa panicoides GN=PCK2 PE=2 SV=1)

HSP 1 Score: 540.036 bits (1390), Expect = 9.067e-153
Identity = 256/312 (82.05%), Postives = 275/312 (88.14%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGPNF 937
            K+G VA               DHNR LIGDDEHCW DNGVSNIEGGCYAKCIDLS+EKEPDIWNAIKFG VLENVVF+E TREVDY+DKS+TENTRAAYPIE+IPNAKIPCVGPHPKNVILLACDA+GVLPPVSKLNLAQTMYHFISGYTA+VAGTEDG+KEPTATFSACFGAAFIM HPTKYAAMLAEKMQK+GATGWLVNTGWSGG YG G+RIKLPYTRKIIDAIHSG LLNA+YKKT+VFG+EIPT + GVPSEIL P NTW DK AYKETLLKLAGLFK NFE+F +YKIG +N LTE+IL   PNF
Sbjct:  315 KEGDVALFFGLSGTGKTTLSTDHNRLLIGDDEHCWSDNGVSNIEGGCYAKCIDLSQEKEPDIWNAIKFGTVLENVVFNERTREVDYADKSITENTRAAYPIEFIPNAKIPCVGPHPKNVILLACDAYGVLPPVSKLNLAQTMYHFISGYTAIVAGTEDGVKEPTATFSACFGAAFIMYHPTKYAAMLAEKMQKYGATGWLVNTGWSGGRYGVGNRIKLPYTRKIIDAIHSGELLNASYKKTEVFGLEIPTAINGVPSEILGPVNTWTDKAAYKETLLKLAGLFKNNFEVFASYKIGNNNSLTEQILAAAPNF 626          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_MAIZE (Phosphoenolpyruvate carboxykinase [ATP] OS=Zea mays PE=2 SV=1)

HSP 1 Score: 532.332 bits (1370), Expect = 1.891e-150
Identity = 256/312 (82.05%), Postives = 270/312 (86.54%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGPNF 937
            KDG VA               DHN  LIGDDEHCW DNGVSNIEGGCYAKCIDL++EKEPDIWNAIKFG VLENVVFDEHTREVDY+D SVTENTRAAYPIEYIP AKIPCVGPHPKNVILLACDAFGVLPPVSKL LAQTMYHFISGYTALVAGTEDGIKEP ATFSACFGAAFIMLHPTKYAAMLAEKMQK+GATGWLVNTGWSGG YG G RI+LPYTRKIIDAIHSG LL ANY+KT+VFG+EIPTE+ GVPSEILDP  TW DK AYKE LL+L GLFK NFE+F +YKIG D+ LT+EIL  GPNF
Sbjct:  355 KDGDVALFFGLSGTGKTTLSTDHNGLLIGDDEHCWSDNGVSNIEGGCYAKCIDLAQEKEPDIWNAIKFGTVLENVVFDEHTREVDYADYSVTENTRAAYPIEYIPIAKIPCVGPHPKNVILLACDAFGVLPPVSKLILAQTMYHFISGYTALVAGTEDGIKEPQATFSACFGAAFIMLHPTKYAAMLAEKMQKYGATGWLVNTGWSGGRYGVGKRIRLPYTRKIIDAIHSGELLTANYQKTEVFGLEIPTEINGVPSEILDPIYTWTDKAAYKENLLRLGGLFKNNFEVFASYKIGDDSSLTDEILAAGPNF 666          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_CUCSA (Phosphoenolpyruvate carboxykinase [ATP] OS=Cucumis sativus GN=PCK PE=2 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 1.956e-147
Identity = 249/310 (80.32%), Postives = 269/310 (86.77%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            K+G VA               DHNRYLIGDDEHCW DNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFG VLENVVFDEHTREVDYS+KSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKL+L QTMYHFISGYTALVAGTE+G+KEP ATFSACFGAAFIMLHP++YAAMLAEKM+KHGATGWLVNTGWSGGSYG G+RIKL YTRKIIDAIHSG+LL ANY KT VFG+EIP  +EGVPS ILDP NTW+DK  Y ETLLKL GLFK+N+E    Y++ +D++L EEIL  GP
Sbjct:  359 KNGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWSDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGTVLENVVFDEHTREVDYSEKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLSLPQTMYHFISGYTALVAGTEEGVKEPQATFSACFGAAFIMLHPSRYAAMLAEKMKKHGATGWLVNTGWSGGSYGSGNRIKLAYTRKIIDAIHSGALLEANYSKTRVFGLEIPDAIEGVPSHILDPINTWSDKDGYHETLLKLGGLFKKNYEGIHTYQVERDSELAEEILAAGP 668          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_DICDI (Phosphoenolpyruvate carboxykinase [ATP] OS=Dictyostelium discoideum GN=pckA PE=1 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 6.367e-106
Identity = 184/289 (63.67%), Postives = 220/289 (76.12%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            D NR LIGDDEH W D G  NIEGGCYAKCIDLSREKEP+I++AIKFGAVLENVV++E++R+VDY+D S+TENTR AYP+E+IPNAK P +  HPKN+I+L CDAFG+LPPVS+L+  Q MYHFI GYTA VAGTE G+ EPTATFS+C+G  FI+ HPTKYA MLA ++ KH A  WL+NTGW+GGS+G GSRIKL YTR IIDAIHSG L      K DVFG ++P    GVPSEIL P N WADK+ Y  T+ KLA LF  NF+ F        +K + E++  GP
Sbjct:  277 DINRELIGDDEHVWTDTGCFNIEGGCYAKCIDLSREKEPEIFDAIKFGAVLENVVYNEYSRKVDYNDVSITENTRCAYPLEHIPNAKFPAIAGHPKNIIMLTCDAFGILPPVSRLDANQVMYHFIQGYTAKVAGTEVGVTEPTATFSSCYGEPFIVWHPTKYAEMLASQLHKHSARAWLINTGWTGGSHGVGSRIKLAYTRAIIDAIHSGELEKIPTTKMDVFGFQVPNSCPGVPSEILMPINGWADKEKYVSTMHKLAKLFIENFKKF-------QDKASPELVAAGP 558          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_CANGA (Phosphoenolpyruvate carboxykinase [ATP] OS=Candida glabrata GN=PCK1 PE=3 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 8.054e-101
Identity = 173/292 (59.25%), Postives = 217/292 (74.32%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGP-HPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSY-GCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQA-YKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            D +R LIGDDEHCW D GV NIEGGCYAKCI+LSREKEP+I++AI+FG+VLENV++D  + EVDY D S+TENTR AYPI++IP+AKIPC+ P HPKN+ILL CDA GVLPPVSKL   Q MYHFISGYT+ +AGTE G+ EP  TFS+CFG  F+ LHP +YA MLAEKM +H A  WL+NTGW+G SY   G R  L YTR I+DAIH GSL  A ++   +F +++P  VEGVPSE+L+P   W++ +A Y+  + KLAGLF  NF+ +        +K T ++L  GP
Sbjct:  258 DPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTY-------QDKATSDVLAAGP 542          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_NEUCR (Phosphoenolpyruvate carboxykinase [ATP] OS=Neurospora crassa GN=pck-1 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.984e-99
Identity = 178/313 (56.87%), Postives = 219/313 (69.97%), Query Frame = 2
Query:    2 KDGXVAXXXXXXXXXXXXXXXDHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGP-HPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYG-CGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTW-ADKQAYKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            KDG V                D NR LIGDDEHCW D GV NIEGGCYAK I LS EKEPDI+NAI++G+VLENVVF+  TREVDY D ++TENTR AYPIEYIPNAKIPC+ P HPKN+ILL CDA GVLPP+SKL+ AQTM+HFISGYT+ +AGTEDGI EP ATFS+CF   F+ LHP +YA MLAEK++ H A  WL+NTGW G  +   G R  L YTR I+DAIHSG L N  Y+  +VF +++P    GVPSE+L+P+  W A   ++   + KL GLF  NF+ +       +++ TE+++  GP
Sbjct:  254 KDGDVTLFFGLSGTGKTTLSADPNRRLIGDDEHCWSDRGVFNIEGGCYAKTIGLSAEKEPDIFNAIRYGSVLENVVFNPETREVDYGDATLTENTRCAYPIEYIPNAKIPCLSPNHPKNIILLTCDARGVLPPISKLDSAQTMFHFISGYTSKMAGTEDGILEPQATFSSCFAQPFLALHPMRYAKMLAEKIENHNANAWLLNTGWVGAGFAQGGKRCPLKYTRAILDAIHSGELANVEYENYEVFNLQVPKSCPGVPSELLNPKTAWTAGANSFDTEVKKLGGLFLENFKKY-------ESEATEDVIKAGP 559          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_ASHGO (Phosphoenolpyruvate carboxykinase [ATP] OS=Ashbya gossypii GN=PCK1 PE=3 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 1.422e-97
Identity = 172/292 (58.90%), Postives = 211/292 (72.26%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGP-HPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGC-GSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEVEGVPSEILDPENTWADKQA-YKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            D +R LIGDDEHCW D GV NIEGGCYAKCI LS EKEP+I+NAIK+G+VLENVV+D  TR VDY D S+TENTR AYPIEYIP+A+IPC+   HP N++LL CDA GVLPPVS+L   Q MYHFISGYT+ +AGTE G+ EP ATFS+CFG  F+ LHP KYA MLAEKM +H A+ WL+NTGW+G SY   G R  L YTR I+D+IH G+L  A Y+   VFG+ IP  VEGVP+E+L+P   W + +  Y   +  LA  F  NF+I+        ++ TEE++  GP
Sbjct:  255 DQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIY-------QDQATEEVVRAGP 539          
BLAST of DC900116 vs. ExPASy Swiss-Prot
Match: PCKA_KLULA (Phosphoenolpyruvate carboxykinase [ATP] OS=Kluyveromyces lactis GN=PCK1 PE=3 SV=2)

HSP 1 Score: 356.295 bits (913), Expect = 1.857e-97
Identity = 172/293 (58.70%), Postives = 213/293 (72.70%), Query Frame = 2
Query:   65 DHNRYLIGDDEHCWGDNGVSNIEGGCYAKCIDLSREKEPDIWNAIKFGAVLENVVFDEHTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGP-HPKNVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSY-GCGSRIKLPYTRKIIDAIHSGSLLNANYKKTDVFGVEIPTEV-EGVPSEILDPENTWADKQA-YKETLLKLAGLFKRNFEIFTNYKIGKDNKLTEEILXXGP 931
            D +R LIGDDEHCW D+GV NIEGGCYAKC+ LS EKEP+I+NAIKFG+VLEN+++D +TREVDY D ++TENTR AYPIEYIP+AKIPC+   HPKN++LL CDA GVLPPVSKL   Q MYHFISGYT+ +AGTE G+ EP ATFS+CFG  F+ LHP KYA MLAEKM +H A  WL+NTGW+G SY   G R  L YTR I+DAIH GSL    Y+   +F ++IP  V + VP+ +L+P   WA+ +A Y   +  LA LF  NF+ +        +K TE++L  GP
Sbjct:  256 DPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTY-------QDKATEQVLAAGP 541          
The following BLAST results are available for this feature:
BLAST of DC900116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 284
Match NameE-valueIdentityDescription
PCKA_ARATH1.265e-15483.33Phosphoenolpyruvate carboxykinase [ATP] OS=Arabido... [more]
PCKA1_UROPA3.681e-15482.69Phosphoenolpyruvate carboxykinase [ATP] 1 OS=Uroch... [more]
PCKA2_UROPA9.067e-15382.05Phosphoenolpyruvate carboxykinase [ATP] 2 OS=Uroch... [more]
PCKA_MAIZE1.891e-15082.05Phosphoenolpyruvate carboxykinase [ATP] OS=Zea may... [more]
PCKA_CUCSA1.956e-14780.32Phosphoenolpyruvate carboxykinase [ATP] OS=Cucumis... [more]
PCKA_DICDI6.367e-10663.67Phosphoenolpyruvate carboxykinase [ATP] OS=Dictyos... [more]
PCKA_CANGA8.054e-10159.25Phosphoenolpyruvate carboxykinase [ATP] OS=Candida... [more]
PCKA_NEUCR1.984e-9956.87Phosphoenolpyruvate carboxykinase [ATP] OS=Neurosp... [more]
PCKA_ASHGO1.422e-9758.90Phosphoenolpyruvate carboxykinase [ATP] OS=Ashbya ... [more]
PCKA_KLULA1.857e-9758.70Phosphoenolpyruvate carboxykinase [ATP] OS=Kluyver... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900116 VSS Citrus sinensis cDNA clone VS27V30 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900116 ID=DC900116|Name=DC900116|organism=Citrus sinensis|type=EST|length=1107bp
AAAAGATGGCNATGTTGCCCTCTTCTTTGGATTGTCAGGTACTGGAAAGA
CAACACTGTCTACTGATCACAATCGATATCTGATTGGAGACGATGAACAC
TGTTGGGGTGACAATGGTGTGTCAAACATTGAGGGTGGTTGCTATGCCAA
GTGCATTGATCTCTCAAGGGAGAAGGAGCCTGATATCTGGAATGCCATCA
AGTTTGGCGCTGTGTTGGAAAATGTTGTGTTTGATGAGCATACCAGAGAG
GTGGATTATTCTGACAAATCTGTCACAGAGAACACTCGTGCTGCCTACCC
CATTGAGTATATCCCCAATGCAAAGATACCATGCGTTGGTCCTCATCCCA
AGAATGTCATCCTTTTGGCATGTGATGCTTTTGGTGTACTCCCACCAGTG
AGCAAGCTGAACCTGGCACAAACAATGTACCATTTCATCAGTGGCTACAC
TGCTTTGGTAGCTGGAACAGAGGATGGTATTAAGGAGCCAACGGCAACAT
TTTCAGCTTGCTTTGGTGCAGCATTTATCATGCTGCATCCTACCAAGTAT
GCAGCAATGCTGGCTGAGAAGATGCAGAAGCATGGTGCTACAGGATGGCT
CGTCAACACTGGATGGTCAGGTGGAAGCTATGGTTGTGGCAGCCGCATCA
AGTTACCGTACACTCGAAAAATCATTGATGCGATACACTCTGGCAGCCTG
TTGAATGCAAATTACAAGAAAACTGATGTATTTGGGGTGGAAATCCCCAC
TGAAGTCGAGGGAGTGCCTTCAGAAATCCTGGATCCAGAGAACACTTGGG
CAGACAAGCAGGCTTACAAGGAGACACTGCTGAAGCTGGCTGGTCTTTTC
AAGAGGAACTTTGAAATATTCACAAACTACAAGATTGGCAAGGACAACAA
GCTCACTGAAGAGATCCTTGNANCTGGTCCAAATTTCTAATTTAGACCGA
GTGAAGAACAAGCAAAGAACGTGAGTGTGGTTTGGGAAATATGATGGAAA
TAAAGCGTAATATAGTCATATTCGACATGTGTGGTTCGATTCATATGTAA
ACTTGTTCTCCTGNATTAATTAAGTAATCCAAAAATTTGAGTCANCGATT
TTAATTA
back to top