DC900102

Overview
NameDC900102
Unique NameDC900102
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length733
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900102 vs. ExPASy Swiss-Prot
Match: PPCE_MOUSE (Prolyl endopeptidase OS=Mus musculus GN=Prep PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.722e-46
Identity = 49/85 (57.65%), Postives = 66/85 (77.65%), Query Frame = -3
Query:  213 QYPSTLLLTADHDDRVVPLHSLKLLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASWIE 467
            QYPS LLLTADHDDRVVPLHSLK +AT+QY++  S +   Q+NP+L  ++ KAGHGAG+PT K+I+E +D + F+A+ L   WI+
Sbjct:  629 QYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEWIQ 710          

HSP 2 Score: 100.523 bits (249), Expect = 3.722e-46
Identity = 43/69 (62.32%), Postives = 52/69 (75.36%), Query Frame = -2
Query:  472 CINQRPDLFGCALAHVGVMDMLRLPKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWEQDPDKP 678
            C NQRPDLFGC +A VGVMDML+  KFTIGHA  ++YGC + K+ F+WL+KYSPLHNV+ P   D   P
Sbjct:  563 CANQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDTKQHFEWLLKYSPLHNVKLPEADDIQYP 631          
BLAST of DC900102 vs. ExPASy Swiss-Prot
Match: PPCE_HUMAN (Prolyl endopeptidase OS=Homo sapiens GN=PREP PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 6.322e-46
Identity = 49/84 (58.33%), Postives = 65/84 (77.38%), Query Frame = -3
Query:  216 QYPSTLLLTADHDDRVVPLHSLKLLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASWI 467
            QYPS LLLTADHDDRVVPLHSLK +AT+QY++  S +   Q+NP+L  ++ KAGHGAG+PT K+I+E +D + F+A+ L   WI
Sbjct:  629 QYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRK---QSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWI 709          

HSP 2 Score: 100.138 bits (248), Expect = 6.322e-46
Identity = 42/69 (60.87%), Postives = 52/69 (75.36%), Query Frame = -2
Query:  472 CINQRPDLFGCALAHVGVMDMLRLPKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWEQDPDKP 678
            C NQRPDLFGC +A VGVMDML+  K+TIGHA  ++YGC + K+ F+WL+KYSPLHNV+ P   D   P
Sbjct:  563 CANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLPEADDIQYP 631          
BLAST of DC900102 vs. ExPASy Swiss-Prot
Match: PPCE_PIG (Prolyl endopeptidase OS=Sus scrofa GN=PREP PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 8.239e-46
Identity = 49/84 (58.33%), Postives = 64/84 (76.19%), Query Frame = -3
Query:  216 QYPSTLLLTADHDDRVVPLHSLKLLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASWI 467
            QYPS LLLTADHDDRVVPLHSLK +AT+QY++  S +   Q NP+L  ++ KAGHGAG+PT K+I+E +D + F+A+ L   WI
Sbjct:  629 QYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDWI 709          

HSP 2 Score: 100.523 bits (249), Expect = 8.239e-46
Identity = 43/69 (62.32%), Postives = 52/69 (75.36%), Query Frame = -2
Query:  472 CINQRPDLFGCALAHVGVMDMLRLPKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWEQDPDKP 678
            C NQRPDLFGC +A VGVMDML+  K+TIGHA  ++YGC + K+ F+WLIKYSPLHNV+ P   D   P
Sbjct:  563 CANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLIKYSPLHNVKLPEADDIQYP 631          
BLAST of DC900102 vs. ExPASy Swiss-Prot
Match: PPCE_RAT (Prolyl endopeptidase OS=Rattus norvegicus GN=Prep PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.074e-45
Identity = 48/85 (56.47%), Postives = 65/85 (76.47%), Query Frame = -3
Query:  213 QYPSTLLLTADHDDRVVPLHSLKLLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASWIE 467
            QYPS LLLTADHDDRVVPLHSLK +AT+QY++  S +   Q+NP+L  ++ KAGHG G+PT K+I+E +D + F+A+ L   WI+
Sbjct:  629 QYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRK---QSNPLLIHVDTKAGHGPGKPTAKVIEEVSDMFAFIARCLNIEWIQ 710          

HSP 2 Score: 100.908 bits (250), Expect = 1.074e-45
Identity = 43/69 (62.32%), Postives = 52/69 (75.36%), Query Frame = -2
Query:  472 CINQRPDLFGCALAHVGVMDMLRLPKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWEQDPDKP 678
            C NQRPDLFGC +A VGVMDML+  KFTIGHA  ++YGC + K+ F+WL+KYSPLHNV+ P   D   P
Sbjct:  563 CANQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYGCSDSKQHFEWLLKYSPLHNVKLPEADDIQYP 631          
BLAST of DC900102 vs. ExPASy Swiss-Prot
Match: PPCE_BOVIN (Prolyl endopeptidase OS=Bos taurus GN=PREP PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.977e-44
Identity = 43/69 (62.32%), Postives = 52/69 (75.36%), Query Frame = -2
Query:  472 CINQRPDLFGCALAHVGVMDMLRLPKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWEQDPDKP 678
            C NQRPDLFGC +A VGVMDML+  K+TIGHA  ++YGC + K+ F+WLIKYSPLHNV+ P   D   P
Sbjct:  563 CANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDNKQHFEWLIKYSPLHNVKLPEADDIQYP 631          

HSP 2 Score: 100.138 bits (248), Expect = 1.977e-44
Identity = 47/85 (55.29%), Postives = 64/85 (75.29%), Query Frame = -3
Query:  213 QYPSTLLLTADHDDRVVPLHSLKLLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLGASWIE 467
            QYPS LLLTADHDDRVVPLHS K +AT+Q+++  S +   Q NP+L  ++ KAGHGAG+PT K+I+E +D + F+A+ L   WI+
Sbjct:  629 QYPSMLLLTADHDDRVVPLHSPKFIATLQHLVGRSRK---QNNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDWIQ 710          
BLAST of DC900102 vs. ExPASy Swiss-Prot
Match: PPCE_DICDI (Prolyl endopeptidase OS=Dictyostelium discoideum GN=prep PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.793e-28
Identity = 41/75 (54.67%), Postives = 48/75 (64.00%), Query Frame = -2
Query:  481 SKAGFLWGCI-NQRPDLFGCALAHVGVMDMLRLPKFTIGHAGFSEYGCPEKKEEFDWLIKYSPLHNVRRPWEQDP 702
            S  G L G I NQRPDLF C +A VGVMDMLR    TIG    S+YG  +  ++FD LIKYSPL+NV +   Q P
Sbjct:  609 SNGGLLMGAISNQRPDLFKCVVADVGVMDMLRFHLHTIGSNWVSDYGRSDNPDDFDVLIKYSPLNNVPKDSNQYP 683          

HSP 2 Score: 71.633 bits (174), Expect = 1.793e-28
Identity = 34/79 (43.04%), Postives = 50/79 (63.29%), Query Frame = -3
Query:  231 QYPSTLLLTADHDDRVVPLHSLKLLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKML 467
            QYPS +L T DHDDRV+P HS K ++ +QY L   ++      P+L R++  +GHGAG+   K  +E AD + F +K+L
Sbjct:  681 QYPSIMLCTGDHDDRVIPAHSYKFISELQYQLGKKVD-----TPLLIRVDKDSGHGAGKGLSKQNNEIADIFNFFSKVL 754          
BLAST of DC900102 vs. ExPASy Swiss-Prot
Match: PPCE_AERHY (Prolyl endopeptidase OS=Aeromonas hydrophila PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 1.500e-23
Identity = 40/79 (50.63%), Postives = 49/79 (62.03%), Query Frame = -3
Query:  228 YPSTLLLTADHDDRVVPLHSLKLLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLG 464
            YPSTL+ TADHDDRVVP HS K  AT+Q        +    +P L RIE  AGHGAG P  K+I+++AD Y F    +G
Sbjct:  611 YPSTLVTTADHDDRVVPAHSFKFAATLQ-------ADDAGPHPQLIRIETNAGHGAGTPVAKLIEQSADIYAFTLFEMG 682          

HSP 2 Score: 53.9138 bits (128), Expect = 1.500e-23
Identity = 33/69 (47.83%), Postives = 38/69 (55.07%), Query Frame = -2
Query:  502 SKAGFLWGCI-NQRPDLFGCALAHVGVMDMLRLPKFTIGHAGFSEYGCPEKKEE-FDWLIKYSPLHNVR 702
            S  G L G +  QRPDL   A   VGV+DMLR   FT G     +YG     E  FD+L  YSPLH+VR
Sbjct:  538 SNGGLLVGAVMTQRPDLMRVACQAVGVLDMLRYHTFTAGAGWAYDYGTSADSEAMFDYLKGYSPLHSVR 606          
BLAST of DC900102 vs. ExPASy Swiss-Prot
Match: PPCF_ELIMR (Prolyl endopeptidase OS=Elizabethkingia miricola PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 7.274e-23
Identity = 37/79 (46.84%), Postives = 48/79 (60.76%), Query Frame = -3
Query:  228 YPSTLLLTADHDDRVVPLHSLKLLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLG 464
            YPST+++T+DHDDRVVP HS K  A +Q             NP+L RIE  AGHGAGR T++++ E AD   F    +G
Sbjct:  629 YPSTMVITSDHDDRVVPAHSFKFGAELQ-------AKQACKNPVLIRIETNAGHGAGRSTEQVVMENADLLSFALYEMG 700          

HSP 2 Score: 56.9954 bits (136), Expect = 7.274e-23
Identity = 33/70 (47.14%), Postives = 41/70 (58.57%), Query Frame = -2
Query:  502 KSKAGFLWGC-INQRPDLFGCALAHVGVMDMLRLPKFTIGHAGFSEYGCPE-KKEEFDWLIKYSPLHNVR 705
            +S  G L G  +  RPDL   A   VGV+DMLR  KFT G     +YG  E  KE F++L  YSP+HNV+
Sbjct:  555 RSNGGLLVGATMTMRPDLAKVAFPGVGVLDMLRYNKFTAGAGWAYDYGTAEDSKEMFEYLKSYSPVHNVK 624          
BLAST of DC900102 vs. ExPASy Swiss-Prot
Match: PPCE_FLAME (Prolyl endopeptidase OS=Flavobacterium meningosepticum GN=f1pep1 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 9.464e-23
Identity = 37/79 (46.84%), Postives = 48/79 (60.76%), Query Frame = -3
Query:  228 YPSTLLLTADHDDRVVPLHSLKLLATMQYVLCTSLENSPQTNPILGRIECKAGHGAGRPTQKMIDEAADCYGFMAKMLG 464
            YPST+++T+DHDDRVVP HS K  + +Q             NPIL RIE  AGHGAGR T++++ E AD   F    +G
Sbjct:  629 YPSTMVITSDHDDRVVPAHSFKFGSELQ-------AKQSCKNPILIRIETNAGHGAGRSTEQVVAENADLLSFALYEMG 700          

HSP 2 Score: 56.9954 bits (136), Expect = 9.464e-23
Identity = 33/70 (47.14%), Postives = 41/70 (58.57%), Query Frame = -2
Query:  502 KSKAGFLWGC-INQRPDLFGCALAHVGVMDMLRLPKFTIGHAGFSEYGCPE-KKEEFDWLIKYSPLHNVR 705
            +S  G L G  +  RPDL   A   VGV+DMLR  KFT G     +YG  E  KE F++L  YSP+HNV+
Sbjct:  555 RSNGGLLVGATMTMRPDLAKVAFPGVGVLDMLRYNKFTAGAGWAYDYGTAEDSKEMFEYLKSYSPVHNVK 624          
The following BLAST results are available for this feature:
BLAST of DC900102 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
PPCE_MOUSE3.722e-4657.65Prolyl endopeptidase OS=Mus musculus GN=Prep PE=2 ... [more]
PPCE_HUMAN6.322e-4658.33Prolyl endopeptidase OS=Homo sapiens GN=PREP PE=1 ... [more]
PPCE_PIG8.239e-4658.33Prolyl endopeptidase OS=Sus scrofa GN=PREP PE=1 SV... [more]
PPCE_RAT1.074e-4556.47Prolyl endopeptidase OS=Rattus norvegicus GN=Prep ... [more]
PPCE_BOVIN1.977e-4462.32Prolyl endopeptidase OS=Bos taurus GN=PREP PE=2 SV... [more]
PPCE_DICDI1.793e-2854.67Prolyl endopeptidase OS=Dictyostelium discoideum G... [more]
PPCE_AERHY1.500e-2350.63Prolyl endopeptidase OS=Aeromonas hydrophila PE=1 ... [more]
PPCF_ELIMR7.274e-2346.84Prolyl endopeptidase OS=Elizabethkingia miricola P... [more]
PPCE_FLAME9.464e-2346.84Prolyl endopeptidase OS=Flavobacterium meningosept... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900102 VSS Citrus sinensis cDNA clone VS27V18 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900102 ID=DC900102|Name=DC900102|organism=Citrus sinensis|type=EST|length=733bp
GTTTTTTTTTTTTTTTTTTAAAACAAAAATTTAATATTCTATCATAACTT
GTTTAATTTTACTAAGAGTTAGAGACACAACTAATCTCTTATTTAAATTA
AAAAAAAAAAGTTCCATCACATCTGTTGAAAAAAAAAAACCAAAGAAATG
GAACTGTCTCCGGTTCCAGAACTTTTCCTAACATTTTCATTCTTTCAGAT
CTACATCAATTACTCAATCCAAGAAGCTCCTAACATTTTTGCCATGAAGC
CATAGCAATCAGCAGCTTCATCAATCATTTTCTGTGTTGGACGTCCAGCT
CCGTGTCCAGCCTTGCACTCGATGCGACCAAGTATTGGATTGGTCTGAGG
GCTATTTTCCAAGCTCGTGCATAAAACATATTGCATAGTCGCCAATAACT
TCAACGAGTGCAAAGGCACAACACGATCATCGTGATCAGCTGTCAATAGT
AGGGTAGATGGGTATTGAGNATGGTTTATCAGGGTCCTGTTCCCATGGTC
TTCTGACATTATGTAATGGGGAGTACTTGATTAGCCAATCAAACTCTTCC
TTCTTCTCTGGACAACCATATTCAGAAAACCCTGCATGACCTATGGTAAA
CTTGGGGAGCCGAAGCATATCCATTACACCAACATGAGCCAGCGCACAAC
CAAAAAGATCAGGTCTCTGATTTATGCAGCCCCATAAGAAGCCCGCCTTG
CTTTTCCTCATACACACTTTTAGACTGGGTTAC
back to top