CN185913

Overview
NameCN185913
Unique NameCN185913
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length790
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7942 contig Csv1_Contig7942:423..1212. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185913 vs. ExPASy Swiss-Prot
Match: CRTZ_ESCVU (Beta-carotene hydroxylase OS=Escherichia vulneris GN=crtZ PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.101e-20
Identity = 52/117 (44.44%), Postives = 73/117 (62.39%), Query Frame = -2
Query:  217 AAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHS 567
            + + ME  A + H+ + H   W  HESHH PR+G FELND+FA++ A  AIAL++ G    G+ P    G G+  TV+G+ Y  VHDGLVH+R+P   I    Y +R+  AH+LHH+
Sbjct:   11 SVIAMEGIAAFTHRYIMHGWGWRWHESHHTPRKGVFELNDLFAVVFAGVAIALIAVG--TAGVWPLQWIGCGM--TVYGLLYFLVHDGLVHQRWPFHWIPRRGYLKRLYVAHRLHHA 123          
BLAST of CN185913 vs. ExPASy Swiss-Prot
Match: CRTZ_PANAN (Beta-carotene hydroxylase OS=Pantoea ananas GN=crtZ PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.590e-19
Identity = 49/115 (42.61%), Postives = 70/115 (60.87%), Query Frame = -2
Query:  217 VGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHS 561
            +GME  A  AHK + H   W  H SHH PR+G FE+ND++A++ A  +I L+  G    G+ P    GAG+  T +G+ Y  VHDGLVH+R+P   I    Y +R+  AH++HH+
Sbjct:   15 IGMEVIAALAHKYIMHGWGWGWHLSHHEPRKGAFEVNDLYAVVFAALSILLIYLG--STGMWPLQWIGAGM--TAYGLLYFMVHDGLVHQRWPFRYIPRKGYLKRLYMAHRMHHA 125          
BLAST of CN185913 vs. ExPASy Swiss-Prot
Match: CRTZ_PARS1 (Beta-carotene hydroxylase OS=Paracoccus sp. (strain PC1) GN=crtZ PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.787e-16
Identity = 48/135 (35.56%), Postives = 74/135 (54.81%), Query Frame = -2
Query:  190 FALSVGAAVGMEFWARWAHKALWHASL-WHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHS--DKFHGVPYG 585
            F + V   + ME  A   H+ + H  L W  H+SHH   +   E ND++ ++ AV A  L + G +   ++    +   LG+TV+G+ Y  +HDGLVH+R+P   I    YFRR+  AH+LHH+   + H V +G
Sbjct:    4 FLIVVATVLVMELTAYSVHRWIMHGPLGWGWHKSHHEEHDHALEKNDLYGVVFAVLATILFTVGAYWWPVL----WWIALGMTVYGLIYFILHDGLVHQRWPFRYIPRRGYFRRLYQAHRLHHAVEGRDHCVSFG 134          
BLAST of CN185913 vs. ExPASy Swiss-Prot
Match: CRTZ_PARSN (Beta-carotene hydroxylase OS=Paracoccus sp. (strain N81106 / MBIC 01143) GN=crtZ PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.376e-15
Identity = 47/135 (34.81%), Postives = 73/135 (54.07%), Query Frame = -2
Query:  190 FALSVGAAVGMEFWARWAHKALWHASL-WHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRRVAAAHQLHHS--DKFHGVPYG 585
            F + V   + ME  A   H+ + H  L W  H+SHH   +   E ND++ ++ AV A  L + G+    ++    +   LG+TV+G+ Y  +HDGLVH+R+P   I    Y RR+  AH+LHH+   + H V +G
Sbjct:    4 FLIVVATVLVMELTAYSVHRWIMHGPLGWGWHKSHHEEHDHALEKNDLYGLVFAVIATVLFTVGWIWAPVL----WWIALGMTVYGLIYFVLHDGLVHQRWPFRYIPRKGYARRLYQAHRLHHAVEGRDHCVSFG 134          
The following BLAST results are available for this feature:
BLAST of CN185913 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
CRTZ_ESCVU1.101e-2044.44Beta-carotene hydroxylase OS=Escherichia vulneris ... [more]
CRTZ_PANAN1.590e-1942.61Beta-carotene hydroxylase OS=Pantoea ananas GN=crt... [more]
CRTZ_PARS14.787e-1635.56Beta-carotene hydroxylase OS=Paracoccus sp. (strai... [more]
CRTZ_PARSN2.376e-1534.81Beta-carotene hydroxylase OS=Paracoccus sp. (strai... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002A22_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002A22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185913 ID=CN185913|Name=CN185913|organism=Citrus sinensis|type=EST|length=790bp
TTTTTTCATATTATTTTTTTCATTATAACACTATTGTTTCTGTACACCGT
TTAAGTGATCCAAAAATTGGTCCTCCCATTAAATTGATCTTTTTGGAACC
CTGTTGTATGATTTGATTCTCTTACTGATCTCCTTCTCCAATTCTTCTAG
TCCCCCCACTTCCTCAAGCTCCTTAGGTCCGAGAAAGAGCCCATATGGGA
CACCGTGGAATTTATCCGAGTGGTGAAGCTGGTGAGCCGCAGCGACTCTC
CGGAAATAAGGCACGTCGGCAATGGGACCCACAGGGAACCTTTTGTGAAC
GAGACCATCGTGGACGAACATGTAGGCCATCCCAAACACCGTAATGCCAA
GTCCAGCACCAAAACAGAGACCAGGTACAAGGCCTTTGTGGAAGAAGCCA
AAAGAGAGAAGGGCTATGGCTGGAACTGCGTTGATTATGGCAAACACATC
GTTTAGCTCAAAAGGACCCTCTCTTGGTCGATGGTGAGACTCGTGCATAT
GCCATAAAGAAGCATGCCACAGAGCTTTATGAGCCCATCGTGCCCAAAAC
TCCATGCCCACAGCAGCACCAACAGAGAGAGCAAATGTGCCAAACATTTC
AGCTAAAGGCACCTCTCCACCCTCCATTTGCCACCAGAACCTGTAATAAA
CAGCCATGACAGCCATGGAAGTGATACCAAAACTAGACATGACGGCAGCA
ACGAGATAAGTGAACCTCTCGGATCTCTTTCTCGCCAATTTCTCGGCCAC
GCGGGCAGCAGTCGAGATCTGGGTACCCGACTCCTCCTCC
back to top