DC900088

Overview
NameDC900088
Unique NameDC900088
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1103
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2287 contig Csv1_Contig2287:180..1282. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_DAUCA (Aspartate aminotransferase, cytoplasmic OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 593.193 bits (1528), Expect = 8.989e-169
Identity = 287/326 (88.04%), Postives = 308/326 (94.48%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVT 978
            DFNKLSAKLI GADSPAI++NRV TVQCLSGTGSLRVG EFLARHYH+ T+YIPQPTWGNHPK+FTLAGLSVKTYRYY+P TRGL+F+G+LEDL +AP GAIVLLHACAHNPTGVDPT+EQWEQIRQLMRSK LLPFFDSAYQGFASGSLDADAQSVR+FVADGGECL AQSYAKNMGLYGERVGALSIVCKT DVAS+VESQLKLVIRPMYSSPP+HGASIVA ILKD  +Y EWTLELKAMADRIISMRQ+LF+AL A+GTPGDWSHI+KQIGMFTFTGLNSEQV FMT EYHIY+TSDGRISMAGLSS+TVPHL DAIHAAVT
Sbjct:   77 DFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHYHEHTVYIPQPTWGNHPKIFTLAGLSVKTYRYYNPETRGLDFEGMLEDLGSAPLGAIVLLHACAHNPTGVDPTIEQWEQIRQLMRSKSLLPFFDSAYQGFASGSLDADAQSVRIFVADGGECLAAQSYAKNMGLYGERVGALSIVCKTADVASKVESQLKLVIRPMYSSPPLHGASIVAAILKDGDLYNEWTLELKAMADRIISMRQELFNALQAKGTPGDWSHIVKQIGMFTFTGLNSEQVTFMTNEYHIYLTSDGRISMAGLSSRTVPHLADAIHAAVT 402          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATC_ORYSJ (Aspartate aminotransferase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os01g0760600 PE=2 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 2.214e-167
Identity = 288/328 (87.80%), Postives = 308/328 (93.90%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            DFNKLSAKLI GADSPAI++NRV TVQCLSGTGSLRVG EFLARHYH+ TIYIPQPTWGNHPKVFTLAGL+V++YRYYDPATRGL+FQGLLEDL +APSGAIVLLHACAHNPTGVDPTL+QWEQIRQLMRSK LLPFFDSAYQGFASGSLD DAQSVRMFVADGGE L+AQSYAKNMGLYGERVGALSIVC + DVA RVESQLKLVIRPMYS+PPIHGASIVATILKDS M+ EWT+ELK MADRIISMRQQLFDAL  R TPGDWSHIIKQIGMFTFTGLNS+QVAFM +EYHIYMTSDGRISMAGLS +T+PHL DAIHAAVT++
Sbjct:   79 DFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHYHERTIYIPQPTWGNHPKVFTLAGLTVRSYRYYDPATRGLDFQGLLEDLGSAPSGAIVLLHACAHNPTGVDPTLDQWEQIRQLMRSKALLPFFDSAYQGFASGSLDQDAQSVRMFVADGGELLMAQSYAKNMGLYGERVGALSIVCGSADVAVRVESQLKLVIRPMYSNPPIHGASIVATILKDSAMFNEWTVELKGMADRIISMRQQLFDALKTRETPGDWSHIIKQIGMFTFTGLNSDQVAFMRQEYHIYMTSDGRISMAGLSGRTIPHLADAIHAAVTKL 406          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT3_ARATH (Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP3 PE=1 SV=1)

HSP 1 Score: 587.8 bits (1514), Expect = 3.777e-167
Identity = 284/327 (86.85%), Postives = 307/327 (93.88%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTR 981
            +FNKLSAKLILGADSPAI++NR+TTV+CLSGTGSLRVG EFLA+HYHQ TIYI QPTWGNHPK+FTLAGL+VKTYRYYDPATRGLNFQGLLEDL AA  G+IVLLHACAHNPTGVDPT++QWEQIR+LMRSKGL+PFFDSAYQGFASGSLD DA+ +RMFVADGGECLVAQSYAKNMGLYGERVGALSIVCK+ DVA RVESQLKLVIRPMYSSPPIHGASIVA IL+D  ++ EWTLELKAMADRIISMR+QLF+AL  RGTPGDWSHIIKQIGMFTFTGLN  QV+FMTKEYHIYMTSDGRISMAGLSSKTVPHL DAIHA VT+
Sbjct:  121 EFNKLSAKLILGADSPAIRENRITTVECLSGTGSLRVGGEFLAKHYHQKTIYITQPTWGNHPKIFTLAGLTVKTYRYYDPATRGLNFQGLLEDLGAAAPGSIVLLHACAHNPTGVDPTIQQWEQIRKLMRSKGLMPFFDSAYQGFASGSLDTDAKPIRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKSADVAGRVESQLKLVIRPMYSSPPIHGASIVAVILRDKNLFNEWTLELKAMADRIISMRKQLFEALRTRGTPGDWSHIIKQIGMFTFTGLNPAQVSFMTKEYHIYMTSDGRISMAGLSSKTVPHLADAIHAVVTK 447          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT2_ARATH (Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana GN=ASP2 PE=1 SV=2)

HSP 1 Score: 587.03 bits (1512), Expect = 6.442e-167
Identity = 288/329 (87.54%), Postives = 306/329 (93.01%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRMG 987
            DFNKLSAKLILGADSPAI ++RVTTVQCLSGTGSLRVGAEFL  HYHQ  IYIP+PTWGNHPKVF LAGLSV+ +RYYDPATRGL+F+GLLEDL AAPSGAIVLLHACAHNPTGVDPT EQWEQIRQLMRSK LLPFFDSAYQGFASGSLD DAQSVR FVADGGECL+AQSYAKNMGLYGERVGALSIVCK+ DVAS+VESQ+KLV+RPMYSSPPIHGASIVATILK S MY  WT+ELK MADRI SMRQQLF+A+ ARGTPGDWSHIIKQIGMFTFTGLN EQV FMTKE+HIYMTSDGRISMAGLSSKTVPHL DA+HAAVTR+G
Sbjct:   77 DFNKLSAKLILGADSPAITESRVTTVQCLSGTGSLRVGAEFLKTHYHQSVIYIPKPTWGNHPKVFNLAGLSVEYFRYYDPATRGLDFKGLLEDLGAAPSGAIVLLHACAHNPTGVDPTSEQWEQIRQLMRSKSLLPFFDSAYQGFASGSLDTDAQSVRTFVADGGECLIAQSYAKNMGLYGERVGALSIVCKSADVASKVESQVKLVVRPMYSSPPIHGASIVATILKSSDMYNNWTIELKEMADRIKSMRQQLFEAIQARGTPGDWSHIIKQIGMFTFTGLNKEQVEFMTKEFHIYMTSDGRISMAGLSSKTVPHLADAMHAAVTRLG 405          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT1_MEDSA (Aspartate aminotransferase 1 OS=Medicago sativa GN=AAT-1 PE=2 SV=2)

HSP 1 Score: 571.237 bits (1471), Expect = 3.658e-162
Identity = 282/328 (85.98%), Postives = 303/328 (92.38%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            DFNKLSAKLI GADSPAI++NRVTTVQ LSGTGSLRVG EFLA+HYHQ  IY+P PTWGNH KVF LAGL+VKTYRYY PATRGL+FQGLLEDL +APSG++VLLHACAHNPTGVDPTLEQWEQIRQL+RSK LLPFFDSAYQGFASGSLDADAQ VR+FVADGGE LVAQSYAKNMGLYGERVGALSIV K+ DV+SRVESQLKLVIRPMYSSPPIHGASIVA ILKD  +Y +WT+ELKAMADRII+MRQQLFDAL ARGTPGDWSHIIKQIGMFTFTGLN EQV+ +TKEYHIY+TSDGRISMAGLSSKTVPHL  AIHA VTR+
Sbjct:   90 DFNKLSAKLIFGADSPAIQENRVTTVQGLSGTGSLRVGGEFLAKHYHQRIIYLPTPTWGNHTKVFNLAGLTVKTYRYYAPATRGLDFQGLLEDLGSAPSGSVVLLHACAHNPTGVDPTLEQWEQIRQLIRSKSLLPFFDSAYQGFASGSLDADAQPVRLFVADGGELLVAQSYAKNMGLYGERVGALSIVSKSADVSSRVESQLKLVIRPMYSSPPIHGASIVAAILKDRDLYNDWTIELKAMADRIINMRQQLFDALRARGTPGDWSHIIKQIGMFTFTGLNPEQVSILTKEYHIYLTSDGRISMAGLSSKTVPHLAHAIHAVVTRV 417          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT4_ARATH (Aspartate aminotransferase, cytoplasmic isozyme 2 OS=Arabidopsis thaliana GN=ASP4 PE=2 SV=2)

HSP 1 Score: 535.413 bits (1378), Expect = 2.224e-151
Identity = 257/328 (78.35%), Postives = 292/328 (89.02%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTRM 984
            +FNKLS KLILG DSPA+K+NRV T QCLSGTGSLRVGAEFLA H  +  I++P PTWGNHP++FTLAGLSV+ +RYYDP +RGL+F+G+LEDL AAP GAIV+L ACAHNPTGVDPT EQWE+IR+L+RSK LLPFFDSAYQGFASGSLDADAQ+VRMFVADGGECL+AQSYAKNMGLYGER+G+L+IVC +EDVA +VE+Q+ LV+RPMY +PPIHGASIVATILK+S MY +WT+ELK MADRIISMRQQL+ AL ARGTPGDWSHIIK IGMFTFTGL+ EQV  M KEYHIYMT DGRISMA LSSKTVP L DAIHA VTR+
Sbjct:   75 EFNKLSTKLILGDDSPALKENRVVTTQCLSGTGSLRVGAEFLATHNKESVIFVPNPTWGNHPRIFTLAGLSVQYFRYYDPKSRGLDFKGMLEDLGAAPPGAIVVLQACAHNPTGVDPTFEQWEKIRRLVRSKSLLPFFDSAYQGFASGSLDADAQAVRMFVADGGECLIAQSYAKNMGLYGERIGSLTIVCTSEDVAKKVENQVLLVVRPMYLTPPIHGASIVATILKNSDMYNDWTIELKGMADRIISMRQQLYAALEARGTPGDWSHIIKHIGMFTFTGLSEEQVRLMAKEYHIYMTYDGRISMASLSSKTVPQLADAIHAVVTRI 402          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_LUPAN (Aspartate aminotransferase P2, mitochondrial (Fragment) OS=Lupinus angustifolius PE=2 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 3.718e-106
Identity = 184/321 (57.32%), Postives = 244/321 (76.01%), Query Frame = 1
Query:    4 FNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAI 963
            FNK +A+L+LGAD+PAIK  RV TVQ LSGTGSLR+GA  + R++    + I  PTWGNH  +F  A +    YRYYDP T GL+F+G++ED++AAP G  VLLH CAHNPTG+DPT EQWE+I  +++ K  +PFFD AYQGFASGSLD DA SVR+FVA G E LVAQSY+KN+GLY ER+GA++++  + + A+RV+SQLK + RPMYS+PP+HGA IVA I+ +  ++ EW +E++ MA RI ++RQQL+D++S++   G DWS I+KQIGMF++TGLN  Q   MT ++H+YMT DGRIS+AGLS     +L DAI
Sbjct:  126 FNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAALIERYFPGAKVLISAPTWGNHKNIFNDARVPWSEYRYYDPKTVGLDFEGMIEDIKAAPEGTFVLLHGCAHNPTGIDPTPEQWEKIADVIQEKNHIPFFDVAYQGFASGSLDEDAASVRLFVARGLEVLVAQSYSKNLGLYAERIGAINVISSSPESAARVKSQLKRIARPMYSNPPVHGARIVADIVGNPALFDEWKVEMEMMAGRIKNVRQQLYDSISSKDKSGKDWSFILKQIGMFSYTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAI 446          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_DICDI (Aspartate aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=aatA PE=3 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 7.011e-105
Identity = 185/326 (56.75%), Postives = 239/326 (73.31%), Query Frame = 1
Query:    4 FNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIHAAVTR 981
            FN+L+A+L LG +   IK+ R+ TVQ +SGTG+LR+ A+F AR     T Y+P PTWGNH  +F  AG+ VK+Y YY+PAT GLNF+ + +D+ AAP G+I+LLHACAHNPTGVDPT EQW++I ++ + +G    FD AYQGFASGS + DA +VRMFV DG    + QS+AKN GLYGER+GA SI+ +T D A  VESQLK++IRPMYS+PP++GA +V  ILKD  +  EW  E+K MADRII+MR+QL   L   G+  DWSHI  QIGMF FTGL  EQV  +  EYHIY+T +GRIS+AG++S  V +L  A+ AAVT+
Sbjct:  100 FNQLAAQLALGEECKHIKEKRIATVQSISGTGALRIAADFFARFLKGKTAYVPNPTWGNHNVIFNDAGIPVKSYGYYNPATCGLNFEAMTKDIAAAPEGSIILLHACAHNPTGVDPTAEQWKKISEICKERGHFVLFDFAYQGFASGSPEKDAAAVRMFVEDGHNIALCQSFAKNFGLYGERIGAFSILTETSDQALNVESQLKILIRPMYSNPPVYGARLVQAILKDKELTNEWRSEVKGMADRIINMREQLVKYLKKHGSTRDWSHITTQIGMFCFTGLTPEQVDRLANEYHIYLTRNGRISIAGINSTNVEYLAKAM-AAVTK 424          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AAT5_ARATH (Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP5 PE=1 SV=2)

HSP 1 Score: 373.629 bits (958), Expect = 1.119e-102
Identity = 177/321 (55.14%), Postives = 235/321 (73.21%), Query Frame = 1
Query:    4 FNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYHQLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPG-DWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAI 963
            FNK +A+L+ GA  P IK+ RV T+Q LSGTGSLR+ A  + R++    + I  PTWGNH  +F  A +    YRYYDP T GL+F+G++ D++ AP G+ +LLH CAHNPTG+DPT EQW +I  +++ K  +PFFD AYQGFASGSLD DA SVR+F   G E  VAQSY+KN+GLY ER+GA+++VC + D A+RV+SQLK + RPMYS+PP+HGA IVA ++ D TM+ EW  E++ MA RI ++RQ+L+D+L ++   G DWS I+KQIGMF+FTGLN  Q   MT ++H+YMT DGRIS+AGLS     +L DAI
Sbjct:  125 FNKATAELLFGAGHPVIKEQRVATIQGLSGTGSLRLAAALIERYFPGAKVVISSPTWGNHKNIFNDAKVPWSEYRYYDPKTIGLDFEGMIADIKEAPEGSFILLHGCAHNPTGIDPTPEQWVKIADVIQEKNHIPFFDVAYQGFASGSLDEDAASVRLFAERGMEFFVAQSYSKNLGLYAERIGAINVVCSSADAATRVKSQLKRIARPMYSNPPVHGARIVANVVGDVTMFSEWKAEMEMMAGRIKTVRQELYDSLVSKDKSGKDWSFILKQIGMFSFTGLNKAQSDNMTDKWHVYMTKDGRISLAGLSLAKCEYLADAI 445          
BLAST of DC900088 vs. ExPASy Swiss-Prot
Match: AATM_CHICK (Aspartate aminotransferase, mitochondrial OS=Gallus gallus GN=GOT2 PE=1 SV=2)

HSP 1 Score: 366.696 bits (940), Expect = 1.368e-100
Identity = 176/323 (54.49%), Postives = 232/323 (71.83%), Query Frame = 1
Query:    1 DFNKLSAKLILGADSPAIKDNRVTTVQCLSGTGSLRVGAEFLARHYH-QLTIYIPQPTWGNHPKVFTLAGLSVKTYRYYDPATRGLNFQGLLEDLRAAPSGAIVLLHACAHNPTGVDPTLEQWEQIRQLMRSKGLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLVAQSYAKNMGLYGERVGALSIVCKTEDVASRVESQLKLVIRPMYSSPPIHGASIVATILKDSTMYKEWTLELKAMADRIISMRQQLFDALSARGTPGDWSHIIKQIGMFTFTGLNSEQVAFMTKEYHIYMTSDGRISMAGLSSKTVPHLTDAIH 966
            DF + SA+L LG +S A K  R  TVQ +SGTGSLRVGA FL R +     +Y+P+P+WGNH  +F  AGL ++ YRYYDP T  L+F G +ED+   P  +I+LLHACAHNPTGVDP  EQW+++  +++ + LL +FD AYQGFASG ++ DA ++R F+  G + +++QSYAKNMGLYGER GA +++C+  + A RVESQLK++IRPMYS+PP++GA I + IL    + KEW +E+K MADRIISMR QL   L   G+  +W HI  QIGMF FTGL  EQV  +TKE+ IYMT DGRIS+AG++S  V +L  AIH
Sbjct:   97 DFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIH 419          
The following BLAST results are available for this feature:
BLAST of DC900088 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
AATC_DAUCA8.989e-16988.04Aspartate aminotransferase, cytoplasmic OS=Daucus ... [more]
AATC_ORYSJ2.214e-16787.80Aspartate aminotransferase, cytoplasmic OS=Oryza s... [more]
AAT3_ARATH3.777e-16786.85Aspartate aminotransferase, chloroplastic OS=Arabi... [more]
AAT2_ARATH6.442e-16787.54Aspartate aminotransferase, cytoplasmic isozyme 1 ... [more]
AAT1_MEDSA3.658e-16285.98Aspartate aminotransferase 1 OS=Medicago sativa GN... [more]
AAT4_ARATH2.224e-15178.35Aspartate aminotransferase, cytoplasmic isozyme 2 ... [more]
AATM_LUPAN3.718e-10657.32Aspartate aminotransferase P2, mitochondrial (Frag... [more]
AATM_DICDI7.011e-10556.75Aspartate aminotransferase, mitochondrial OS=Dicty... [more]
AAT5_ARATH1.119e-10255.14Aspartate aminotransferase, chloroplastic OS=Arabi... [more]
AATM_CHICK1.368e-10054.49Aspartate aminotransferase, mitochondrial OS=Gallu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900088 VSS Citrus sinensis cDNA clone VS27V02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900088 ID=DC900088|Name=DC900088|organism=Citrus sinensis|type=EST|length=1103bp
GATTTTAATAAATTGAGTGCAAAGCTCATCCTTGGTGCTGACAGCCCTGC
GATTAAAGACAACAGAGTGACCACCGTTCAGTGCTTGTCTGGCACTGGTT
CTTTGAGGGTTGGAGCTGAGTTTCTGGCAAGGCATTATCACCAACTTACC
ATATATATTCCACAGCCAACATGGGGAAACCATCCCAAAGTTTTCACTTT
AGCAGGATTGTCTGTGAAGACCTACCGCTATTATGATCCAGCAACACGTG
GGCTAAACTTCCAAGGCTTGCTGGAGGATCTTAGGGCTGCACCATCCGGA
GCTATAGTTCTTCTTCATGCATGTGCTCATAATCCAACTGGTGTTGACCC
GACCCTTGAGCAGTGGGAGCAGATCAGGCAGCTGATGAGGTCAAAAGGAT
TGTTACCTTTCTTTGACAGTGCTTATCAGGGTTTTGCAAGTGGTAGCCTA
GATGCAGATGCACAATCTGTTCGCATGTTTGTGGCAGATGGTGGCGAATG
CCTGGTAGCTCAGAGTTATGCGAAAAACATGGGACTCTATGGGGAACGTG
TCGGCGCCCTCAGCATTGTCTGCAAGACAGAAGATGTGGCAAGCAGGGTT
GAAAGCCAGTTGAAACTCGTGATTAGGCCCATGTACTCTAGTCCACCTAT
TCACGGGGCCTCTATTGTGGCTACAATTCTCAAGGACAGCACTATGTATA
AAGAGTGGACTCTTGAACTGAAAGCGATGGCTGACCGGATTATAAGCATG
CGTCAGCAACTATTTGATGCTCTGTCTGCTAGAGGCACTCCAGGAGACTG
GAGTCACATTATCAAGCAAATAGGAATGTTTACATTCACAGGGCTGAACA
GTGAACAAGTTGCCTTCATGACCAAGGAGTATCACATTTATATGACATCT
GATGGGAGGATTAGCATGGCAGGTCTTAGTTCAAAGACAGTTCCTCATCT
TACCGATGCTATACATGCTGCTGTAACCCGAATGGGCTAAGATTAATCAG
ACAAGAATTCATGCCGTAAGAATTGTTTGGTTTTCAGTCACCCTCAGCAA
TGCAAAAATGAGTTTGTAGAACTAGAAAATGCATAAATAAAGGTTTTACA
TTA
back to top