DC900087

Overview
NameDC900087
Unique NameDC900087
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length703
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11196 contig Csv1_Contig11196:116..818. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900087 vs. ExPASy Swiss-Prot
Match: PTEN_MOUSE (Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Mus musculus GN=Pten PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.903e-11
Identity = 32/61 (52.46%), Postives = 45/61 (73.77%), Query Frame = 3
Query:  471 RHVVSQNKRRYQDGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE 653
            + +VS+NKRRYQ+ GFDLD+TYI  NIIAMGFPA  +        EG YRN++++V++F +
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFLD 58          
BLAST of DC900087 vs. ExPASy Swiss-Prot
Match: PTEN_HUMAN (Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens GN=PTEN PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.903e-11
Identity = 32/61 (52.46%), Postives = 45/61 (73.77%), Query Frame = 3
Query:  471 RHVVSQNKRRYQDGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE 653
            + +VS+NKRRYQ+ GFDLD+TYI  NIIAMGFPA  +        EG YRN++++V++F +
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFLD 58          
BLAST of DC900087 vs. ExPASy Swiss-Prot
Match: PTEN_CANFA (Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Canis familiaris GN=PTEN PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.903e-11
Identity = 32/61 (52.46%), Postives = 45/61 (73.77%), Query Frame = 3
Query:  471 RHVVSQNKRRYQDGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE 653
            + +VS+NKRRYQ+ GFDLD+TYI  NIIAMGFPA  +        EG YRN++++V++F +
Sbjct:    6 KEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFLD 58          
BLAST of DC900087 vs. ExPASy Swiss-Prot
Match: TPTE2_HUMAN (Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Homo sapiens GN=TPTE2 PE=1 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 3.419e-11
Identity = 32/61 (52.46%), Postives = 41/61 (67.21%), Query Frame = 3
Query:  471 RHVVSQNKRRYQDGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE 653
            R +VS+NKRRY   GFDLD+TY+TE IIAM FP+    S        FYRN +EEV++F +
Sbjct:  202 RRLVSENKRRYTRDGFDLDLTYVTERIIAMSFPSSGRQS--------FYRNPIEEVVRFLD 254          

HSP 2 Score: 21.1718 bits (43), Expect = 3.419e-11
Identity = 11/29 (37.93%), Postives = 16/29 (55.17%), Query Frame = 1
Query:  334 HLQNLLSQMIVLRGLQQLHNLVLLDQLQR 420
            HL  LL  +I++R    LH    L++L R
Sbjct:  174 HLVRLLRLIILIRIFHLLHQKRQLEKLMR 202          
BLAST of DC900087 vs. ExPASy Swiss-Prot
Match: PTEN_XENLA (Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Xenopus laevis GN=pten PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.446e-11
Identity = 32/61 (52.46%), Postives = 44/61 (72.13%), Query Frame = 3
Query:  471 RHVVSQNKRRYQDGGFDLDMTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFE 653
            +  VS+NKRRYQ+ GFDLD+TYI  NIIAMGFPA  +        EG YRN++++V++F +
Sbjct:    6 KEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERL--------EGVYRNNIDDVVRFLD 58          
The following BLAST results are available for this feature:
BLAST of DC900087 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
PTEN_MOUSE2.903e-1152.46Phosphatidylinositol-3,4,5-trisphosphate 3-phospha... [more]
PTEN_HUMAN2.903e-1152.46Phosphatidylinositol-3,4,5-trisphosphate 3-phospha... [more]
PTEN_CANFA2.903e-1152.46Phosphatidylinositol-3,4,5-trisphosphate 3-phospha... [more]
TPTE2_HUMAN3.419e-1152.46Phosphatidylinositol-3,4,5-trisphosphate 3-phospha... [more]
PTEN_XENLA8.446e-1152.46Phosphatidylinositol-3,4,5-trisphosphate 3-phospha... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900087 VSS Citrus sinensis cDNA clone VS27V01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900087 ID=DC900087|Name=DC900087|organism=Citrus sinensis|type=EST|length=703bp
CTCAACTGGACTCCAATTCCAATCCCGTGTTCGTGAATTTTATCATCAAT
CACCATTGAGACCTCTAAGGAGCCGGAATGGATTCTGGATCTGCTGATTC
ATCAGCTTCGCCTCTTACGAAGGCTTCTGAAGTAAAACCTTCTCCTACTA
CAGAATCTGCTACAGATAATTCTGCAAGTGATGCACGATCAAAGATTTCT
GCTACTGGGATATCATCATGGGCCAAAAATTTGAAAATTCCTCAGCCATT
TTCTGGCTCACAAGAGGATTCACCAACTGGAAATTCTGGAAAATCAACTT
TTGCACGTCTTACTAGTGGCTTAGGACTGCGCTCATCTCCAAAATCTCCT
CAGTCAGATGATAGTTCTGAGGGGACTTCAACAGCTGCACAACCTGGTTT
TATTGGATCAATTACAAAGGGGTTGGTTGACTCGTCTAAGAGTGCAGTGA
AGGCTGTACAGGTCAAGGCTCGCCATGTTGTCTCTCAAAATAAACGAAGA
TACCAGGATGGAGGATTTGATTTGGATATGACATATATCACTGAGAATAT
AATTGCAATGGGATTCCCTGCTGGTGACATGAGCTCAGGGTTTTTCGGAT
ATGTTGAGGGATTCTACCGAAACCACATGGAAGAAGTGATTAAATTCTTT
GAACCTATCCAGGACAGTCCAAGNGACATCTTGTAAAGAGCTTATGATGC
TCG
back to top