CN185909
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: GOX2_ARATH (Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 OS=Arabidopsis thaliana GN=At3g14420 PE=1 SV=1) HSP 1 Score: 105.916 bits (263), Expect = 2.816e-22 Identity = 50/56 (89.29%), Postives = 54/56 (96.43%), Query Frame = 2 Query: 656 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSK 823 EITNV EY+A+AK+KLPKMVYDYYASGAEDQWTLQENRNAF+RILFRPRIL DVSK Sbjct: 2 EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSK 57
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: GOX1_ARATH (Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 OS=Arabidopsis thaliana GN=At3g14415 PE=1 SV=1) HSP 1 Score: 103.605 bits (257), Expect = 1.397e-21 Identity = 49/56 (87.50%), Postives = 53/56 (94.64%), Query Frame = 2 Query: 656 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVSK 823 EITNV EY+A+AK KLPKMVYDYYASGAEDQWTLQENRNAF+RILFRPRIL DV+K Sbjct: 2 EITNVTEYDAIAKAKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNK 57
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: GOX_SPIOL (Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1) HSP 1 Score: 102.449 bits (254), Expect = 3.113e-21 Identity = 49/55 (89.09%), Postives = 52/55 (94.55%), Query Frame = 2 Query: 656 EITNVMEYEALAKEKLPKMVYDYYASGAEDQWTLQENRNAFSRILFRPRILRDVS 820 EITNV EYEA+AK+KLPKMVYDYYASGAEDQWTL ENRNAFSRILFRPRIL DV+ Sbjct: 2 EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVT 56
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1) HSP 1 Score: 96.6709 bits (239), Expect = 1.708e-19 Identity = 43/52 (82.69%), Postives = 47/52 (90.38%), Query Frame = -2 Query: 309 TATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 464 TA C+DIL+A+I PPLGVFLKFGC EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2) HSP 1 Score: 96.6709 bits (239), Expect = 1.708e-19 Identity = 43/52 (82.69%), Postives = 47/52 (90.38%), Query Frame = -2 Query: 309 TATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 464 TA C+DIL+A+I PPLGVFLKFGC EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1) HSP 1 Score: 94.7449 bits (234), Expect = 6.491e-19 Identity = 44/57 (77.19%), Postives = 49/57 (85.96%), Query Frame = -2 Query: 309 MADGSTATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 479 MAD STATC+DI+LA+I PPLGVF KFGC EFWICLLLT GY+PGIIYAV+ ITK Sbjct: 1 MAD-STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1) HSP 1 Score: 92.4337 bits (228), Expect = 3.221e-18 Identity = 40/53 (75.47%), Postives = 48/53 (90.57%), Query Frame = -2 Query: 309 STATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 467 STAT V+I+LA+I PPLGVFLKFGCK EFWICL+LT+ GY+PGI+YA+Y ITK Sbjct: 2 STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 5.495e-18 Identity = 39/53 (73.58%), Postives = 48/53 (90.57%), Query Frame = -2 Query: 309 STATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 467 STAT VDI++A++ PPLGVFL+FGC EFWICL+LT+LGYIPGIIYA+Y +TK Sbjct: 2 STATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: OSR8_ORYSJ (Hydrophobic protein OSR8 OS=Oryza sativa subsp. japonica GN=OSR8 PE=3 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 1.655e-14 Identity = 39/56 (69.64%), Postives = 45/56 (80.36%), Query Frame = -2 Query: 315 MADGSTATCVDILLAVISPPLGVFLKFGC-KAEFWICLLLTILGYIPGIIYAVYAI 479 MA G T ++ILLA+I PPLGVFL+FGC EF ICLLLTILGY+PGIIYAVY + Sbjct: 1 MASGRCCTFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVYVL 56
BLAST of CN185909 vs. ExPASy Swiss-Prot
Match: LT02_HORVU (Low temperature-induced protein lt101.2 OS=Hordeum vulgare GN=LT101.2 PE=2 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 1.655e-14 Identity = 33/51 (64.71%), Postives = 45/51 (88.24%), Query Frame = -2 Query: 315 STATCVDILLAVISPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 467 ++AT ++++LA+I PP+GVFL++G EFWICLLLT+LGYIPGIIYAVY + Sbjct: 2 ASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTLLGYIPGIIYAVYVL 52 The following BLAST results are available for this feature:
BLAST of CN185909 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 14
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN185909 ID=CN185909; Name=CN185909; organism=Citrus sinensis; type=EST; length=825bpback to top |