DC900085

Overview
NameDC900085
Unique NameDC900085
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length616
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1651 contig Csv1_Contig1651:201..816. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900085 vs. ExPASy Swiss-Prot
Match: ENL3_ARATH (Early nodulin-like protein 3 OS=Arabidopsis thaliana GN=At5g25090 PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 5.644e-39
Identity = 76/132 (57.58%), Postives = 100/132 (75.76%), Query Frame = 3
Query:    6 SWKIPSSQSDSLNQWAEKTRFQVGDSLVWKYDATRDSVLQVTKEAYLSCNTSSPVAEYRDGNXKVKLNKSGPFYFISGTKGSCEKGQKLIVVVMSSRRRYTG-------ISPAPAPMEFDGPAVAPTSSAAS 380
            SWKIPSS S+SLN+WAE  RF+VGD+LVWKYD  +DSVLQVTK+AY++CNT++P A Y +G+ KVKL +SGP++FISG+K +C +G+KL +VVMSSR  +TG        SPAP+P     P VAP S  ++
Sbjct:   34 SWKIPSSPSESLNKWAESLRFRVGDTLVWKYDEEKDSVLQVTKDAYINCNTTNPAANYSNGDTKVKLERSGPYFFISGSKSNCVEGEKLHIVVMSSRGGHTGGFFTGSSPSPAPSPALLGAPTVAPASGGSA 165          
BLAST of DC900085 vs. ExPASy Swiss-Prot
Match: ENL1_ARATH (Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 6.240e-38
Identity = 76/127 (59.84%), Postives = 100/127 (78.74%), Query Frame = 3
Query:    9 WKIPSSQSDSLNQWAEKTRFQVGDSLVWKYDATRDSVLQVTKEAYLSCNTSSPVAEYRDGNXKVKLNKSGPFYFISGTKGSCEKGQKLIVVVMSSRRRYTGISPAPAPMEF-DGPAVAPTSSAASFK 386
            WKIP S S S  +WA+K RF+VGD +V++Y++ +DSVL+VTKEAY SCNT++P+A Y DG  KVKL++SGPFYFISG  G CEKGQKL +VV+S   R++ ISPAP+P+EF DGPA+AP   + S +
Sbjct:   40 WKIPPSSSYSFTEWAQKARFKVGDFIVFRYESGKDSVLEVTKEAYNSCNTTNPLANYTDGETKVKLDRSGPFYFISGANGHCEKGQKLSLVVISP--RHSVISPAPSPVEFEDGPALAPAPISGSVR 164          
BLAST of DC900085 vs. ExPASy Swiss-Prot
Match: ENL2_ARATH (Early nodulin-like protein 2 OS=Arabidopsis thaliana GN=At4g27520 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.307e-19
Identity = 52/121 (42.98%), Postives = 74/121 (61.16%), Query Frame = 3
Query:   33 DSLNQWAEKTRFQVGDSLVWKYDATRDSVLQVTKEAYLSCNTSSPVAEYRDGNXKVKLNKSGPFYFISGTKGSCEKGQKLIVVVMSSRRRYTGISP-APAPMEFDGPAVAPTSSAASFKAS 392
            ++   W+ K RF V D+L + Y    DSVL+V K  Y +CNT +P+    DG+ ++ L++ GPFYFISG + +C+KGQKL VVV+S+R   T  SP A AP      ++ P   A S K+S
Sbjct:   45 ENYESWSGKNRFLVHDTLYFSYAKGADSVLEVNKADYDACNTKNPIKRVDDGDSEISLDRYGPFYFISGNEDNCKKGQKLNVVVISARIPSTAQSPHAAAPGSSTPGSMTPPGGAHSPKSS 165          
BLAST of DC900085 vs. ExPASy Swiss-Prot
Match: NO552_SOYBN (Early nodulin-55-2 OS=Glycine max GN=ENOD55-2 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 9.368e-18
Identity = 48/124 (38.71%), Postives = 73/124 (58.87%), Query Frame = 3
Query:    6 SWKIPSSQSDSLNQWAEKTRFQVGDSLVWKYDATRDSVLQVTKEAYLSCNTSSPV-AEYRDGNXKVKLNKSGPFYFISGTKGSCEKGQKLIVVVMSSRR-RYTGISPAPAPMEFDGPAVAPTSS 371
            SWK P S+ DSL+ WA   RF++GD+L++KY+   +SV +  +  Y  CNT       +  GN KV L K G  +FISG +  C+ G KL V+V+SS + +   +SP+P+P       ++P+ S
Sbjct:   37 SWKFPLSKPDSLSHWANSHRFKIGDTLIFKYEKRTESVHEGNETDYEGCNTVGKYHIVFNGGNTKVMLTKPGFRHFISGNQSHCQMGLKLAVLVISSNKTKKNLLSPSPSPSPPPSSLLSPSPS 160          
BLAST of DC900085 vs. ExPASy Swiss-Prot
Match: NO16_MEDTR (Early nodulin-16 OS=Medicago truncatula GN=ENOD16 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.931e-17
Identity = 40/96 (41.67%), Postives = 61/96 (63.54%), Query Frame = 3
Query:    3 DSWKIPSSQSDSLNQWAEKTRFQVGDSLVWKYDATRDSVLQVTKEAYLSCNTSSPVAEYRDGNXKVKLNKSGPFYFISGTKGSCEKGQKLIVVVMS 290
            +SWK+P     +  +WA    F VGD+++++YD   +SV +V +  Y+ C+T+    E+ DGN KV L+K G ++FISGTK  C+ G KL VVV +
Sbjct:   34 NSWKVPLPSRRAFARWASAHEFTVGDTILFEYDNETESVHEVNEHDYIMCHTNGEHVEHHDGNTKVVLDKIGVYHFISGTKRHCKMGLKLAVVVQN 129          
BLAST of DC900085 vs. ExPASy Swiss-Prot
Match: MAVI_CUCPE (Mavicyanin OS=Cucurbita pepo PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.684e-14
Identity = 35/80 (43.75%), Postives = 50/80 (62.50%), Query Frame = 3
Query:   45 QWAEKTRFQVGDSLVWKYDATRDSVLQVTKEAYLSCNTSSPVAEYRDGNXKVKLNKSGPFYFISGTKGSCEKGQKLIVVV 284
            +WA   +F VGDSL++ Y+    +VLQV +E + SCN+SSP A Y  G   + L + G FYF+ G  G C+ GQK+ + V
Sbjct:   22 KWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKV 101          
BLAST of DC900085 vs. ExPASy Swiss-Prot
Match: NO20_MEDTR (Early nodulin-20 OS=Medicago truncatula GN=ENOD20 PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.073e-13
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = 3
Query:    3 DSWKIPSSQSDSLNQWAEKTRFQVGDSLVWKYDATRDSVLQVTKEAYLSCNTSSPVAEYRDGNXKVKLNKSGPFYFISGTKGSCEKGQKLIVVVM 287
            +SWK P     +L +WA   +F VGD++ ++Y+   +SV +V +E Y  C       ++ DGN  V L K+G  +FISG K  C  G KL VVVM
Sbjct:   34 NSWKFPLPTRHALTRWASNYQFIVGDTITFQYNNKTESVHEVEEEDYDRCGIRGEHVDHYDGNTMVVLKKTGIHHFISGKKRHCRLGLKLAVVVM 128          
BLAST of DC900085 vs. ExPASy Swiss-Prot
Match: STEL_RHUVE (Stellacyanin OS=Rhus vernicifera PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.640e-12
Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 3
Query:    9 WKIPS-SQSDSLNQWAEKTRFQVGDSLVWKYDATRDSVLQVTKEAYLSCNTSSPVAEYRDGNXKVKLNKSGPFYFISGTKGSCEKGQKLIVVV 284
            WK+P     D   +WA    F +GD LV+KYD    +V +VT++ Y SCN ++P+A Y  G+ ++ L   G  Y+I G    C+ GQK+ + V
Sbjct:   11 WKVPFFGDVDYDWKWASNKTFHIGDVLVFKYDRRFHNVDKVTQKNYQSCNDTTPIASYNTGBBRINLKTVGQKYYICGVPKHCDLGQKVHINV 103          
BLAST of DC900085 vs. ExPASy Swiss-Prot
Match: NO551_SOYBN (Early nodulin-55-1 (Fragment) OS=Glycine max GN=ENOD55-1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 4.979e-11
Identity = 41/103 (39.81%), Postives = 57/103 (55.34%), Query Frame = 3
Query:   93 KYDATRDSVLQVTKEAYLSCNT-SSPVAEYRDGNXKVKLNKSGPFYFISGTKGSCEKGQKLIVVVMSSRRRYTGI------SPAPAPMEFDGPAVAPTSSAAS 380
            KYD   +SV +V +  Y  CNT       + DGN KV L KSG  +FISG +  C+ G KL+VVVMS+  +   I      SP+P+P     P+ +P+ S +S
Sbjct:    1 KYDERTESVHEVNETDYEQCNTVGKEHVLFNDGNTKVMLTKSGFRHFISGNQSHCQMGLKLMVVVMSNNTKKKLIHSPSPSSPSPSPSPSPSPSPSPSPSLSS 103          
The following BLAST results are available for this feature:
BLAST of DC900085 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
ENL3_ARATH5.644e-3957.58Early nodulin-like protein 3 OS=Arabidopsis thalia... [more]
ENL1_ARATH6.240e-3859.84Early nodulin-like protein 1 OS=Arabidopsis thalia... [more]
ENL2_ARATH1.307e-1942.98Early nodulin-like protein 2 OS=Arabidopsis thalia... [more]
NO552_SOYBN9.368e-1838.71Early nodulin-55-2 OS=Glycine max GN=ENOD55-2 PE=2... [more]
NO16_MEDTR7.931e-1741.67Early nodulin-16 OS=Medicago truncatula GN=ENOD16 ... [more]
MAVI_CUCPE3.684e-1443.75Mavicyanin OS=Cucurbita pepo PE=1 SV=1[more]
NO20_MEDTR4.073e-1340.00Early nodulin-20 OS=Medicago truncatula GN=ENOD20 ... [more]
STEL_RHUVE2.640e-1237.63Stellacyanin OS=Rhus vernicifera PE=1 SV=1[more]
NO551_SOYBN4.979e-1139.81Early nodulin-55-1 (Fragment) OS=Glycine max GN=EN... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900085 VSS Citrus sinensis cDNA clone VS27Q93 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900085 ID=DC900085|Name=DC900085|organism=Citrus sinensis|type=EST|length=616bp
CAGATTCTTGGAAAATCCCTTCTTCACAATCTGATTCCCTCAATCAATGG
GCTGAAAAAACTCGCTTCCAAGTCGGGGATTCTCTAGTGTGGAAATATGA
TGCCACCAGAGACTCAGTGCTGCAAGTGACAAAAGAAGCTTACCTCAGCT
GCAACACAAGCAGCCCAGTTGCTGAGTACAGGGATGGCAACNCCAAGGTG
AAGCTGAACAAATCTGGGCCATTCTACTTCATCAGTGGAACCAAGGGAAG
CTGTGAGAAAGGCCAGAAGTTGATTGTTGTCGTGATGTCTTCGAGGAGAA
GGTACACTGGCATTTCTCCGGCACCGGCTCCGATGGAGTTCGATGGTCCG
GCCGTGGCTCCTACAAGCAGTGCTGCAAGCTTTAAGGCTAGTTTGGTGCT
GGCNCTTGGAGGTCTTTTGGCTTGGGTTCTGTTTTAATTTTAGACCAGCT
TANATGTTGGAGTTTAGGGTATAGGAGATTTTTTGCTTAGGTATTGTGGG
GGTGAAATTATTTCATTCTTTTTTCTTCTTTTTTCCTTCTCTTTGAATGT
GGAATTTTGCTGAGATTTTTACAGCAATATAATCTATTGTCTGTTTTTGC
TATATAGAATCCTTTT
back to top