DC900077

Overview
NameDC900077
Unique NameDC900077
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length830
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5636 contig Csv1_Contig5636:1..829. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900077 vs. ExPASy Swiss-Prot
Match: SAP1_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 1 OS=Arabidopsis thaliana GN=SAP1 PE=1 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 2.024e-52
Identity = 101/171 (59.06%), Postives = 119/171 (69.59%), Query Frame = 3
Query:  132 MGSEQSDGTSYTTSEPKLCVNGCAFFGTAANMGLCSKCYRDLRVKEDQAASAKAAMEKSLNLKSPKQIHQTPELETAKVAAEPFVGXXXXXXXXXXXXVEQPEPQAKGPTRCLSCNKKVGLTGFKCKCGSTFCGIHRYPEKHDCTFDFKVTGRDAIARANPVVKADKLDRI 644
            MGSEQ+D TS++ SEPKLCV GC FFG+ +NM LCSKCYRD+R  E+Q ASAKAA+EKSLN   PK   Q  +  T  V                   ++ P+  A   TRCLSCNKKVG+TGFKC+CGSTFCG HRYPE H+C FDFK   R+AIA+ANPVVKADK+DRI
Sbjct:    1 MGSEQNDSTSFSPSEPKLCVKGCGFFGSPSNMNLCSKCYRDIRATEEQTASAKAAVEKSLNPNKPKTQPQQSQEITQGVLGSGSSSSSTRGGDSAAAPLDPPKSTA---TRCLSCNKKVGVTGFKCRCGSTFCGTHRYPESHECQFDFKGVAREAIAKANPVVKADKVDRI 168          
BLAST of DC900077 vs. ExPASy Swiss-Prot
Match: SAP7_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 7 OS=Arabidopsis thaliana GN=SAP7 PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.228e-49
Identity = 103/184 (55.98%), Postives = 121/184 (65.76%), Query Frame = 3
Query:  132 MGSEQSDGTSYTTSEPKLCVNGCAFFGTAANMGLCSKCYRDLRVKEDQAASAKAAMEKSLNLKS-----PKQIH----QTPELETAKVAAEPFVGXXXXXXXXXXXXVEQPEPQAKGPTR----CLSCNKKVGLTGFKCKCGSTFCGIHRYPEKHDCTFDFKVTGRDAIARANPVVKADKLDRI 644
            MGSE+++ TS+  +EPKLC NGC FFG+ +NM LCSKCYR LR +EDQ A AKAA++ SL L S     P Q H    +   LET  V AEP                EQ E +   P R    C SCNKKVG+ GFKCKCGSTFCG HRYPEKH+C+FDFK  GRDAIA+ANP+VKADK+ RI
Sbjct:    1 MGSEENNSTSFPPTEPKLCDNGCGFFGSPSNMNLCSKCYRSLRAEEDQTAVAKAAVKNSLKLPSCSIIAPGQKHPLEIKPAHLETVVVTAEP---------SSVPVAAEQDEAEPSRPVRPNNRCFSCNKKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVGRDAIAKANPLVKADKVQRI 175          
BLAST of DC900077 vs. ExPASy Swiss-Prot
Match: SAP9_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 9 OS=Arabidopsis thaliana GN=SAP9 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.029e-44
Identity = 94/175 (53.71%), Postives = 108/175 (61.71%), Query Frame = 3
Query:  132 MGSEQSDGTSYT---TSEPKLCVNGCAFFGTAANMGLCSKCYRDLRVKEDQAASAKAAMEKSLNLKSPKQIH-QTPELETAKVAAEPFVGXXXXXXXXXXXXVEQPEPQAKGPT-RCLSCNKKVGLTGFKCKCGSTFCGIHRYPEKHDCTFDFKVTGRDAIARANPVVKADKLDR 641
            MGSEQ+D TS+T    SEPKLCV GC FFG+ +NM LCSKCYR +  +E Q A AKAA+EKS     P+ +    P     +   E                 E  EP     T RCL CNKKVG+ GFKCKCGSTFCG HRYPE HDC+FDFK  GR  IA+ANPVVKADK+ R
Sbjct:    1 MGSEQNDSTSFTQSQASEPKLCVKGCGFFGSPSNMDLCSKCYRGICAEEAQTAVAKAAVEKSFKPSPPRSLFIAEPPAVVVEPKPEKAAVVVVSAEPSSSAVPEANEPSRPARTNRCLCCNKKVGIMGFKCKCGSTFCGEHRYPETHDCSFDFKEVGRGEIAKANPVVKADKIQR 175          
BLAST of DC900077 vs. ExPASy Swiss-Prot
Match: SAP2_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 2 OS=Arabidopsis thaliana GN=SAP2 PE=2 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 7.728e-36
Identity = 75/161 (46.58%), Postives = 100/161 (62.11%), Query Frame = 3
Query:  177 PKLCVNGCAFFGTAANMGLCSKCYRDLRVKEDQAA---SAKAAMEKSLNLKSPKQIHQTPELETAKVAAEPFVGXXXXXXXXXXXXVEQPEPQAK--GPTRCLSCNKKVGLTGFKCKCGSTFCGIHRYPEKHDCTFDFKVTGRDAIARANPVVKADKLDRI 644
            PKLC N C FFG+AA M +CSKC++D+  +++Q A   SA +    S N+          ++ET  V  EP               V  PE  AK  GP+RC +CNK+VGLTGFKC+CGS FCG HRY + HDC+F++    ++AIA+ANPVVKA+KLD+I
Sbjct:   15 PKLCTNNCGFFGSAATMNMCSKCHKDMLFQQEQGAKFASAVSGTSSSSNIIKETFTAALVDIETKSV--EPMTVSVQPSSVQVVAEVVAPEEAAKPKGPSRCTTCNKRVGLTGFKCRCGSLFCGTHRYADVHDCSFNYHAAAQEAIAKANPVVKAEKLDKI 173          
BLAST of DC900077 vs. ExPASy Swiss-Prot
Match: SAP8_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. japonica GN=SAP8 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.116e-34
Identity = 73/176 (41.48%), Postives = 110/176 (62.50%), Query Frame = 3
Query:  126 KKMGSEQSDGTSYTTSEPKLCVNGCAFFGTAANMGLCSKCYRDLRVKEDQAASAKAAMEKSLNL-KSPKQ--IHQTPELETAKVAAEPFVGXXXXXXXXXXXXVEQPEPQAKGPTRCLSCNKKVGLTGFKCKCGSTFCGIHRYPEKHDCTFDFKVTGRDAIARANPVVKADKLDRI 644
            K+ G +Q +G       P LC+N C FFG+AA M +CSKC++++ +K++QA  A ++++  +N   S K+  I    E+  A+V  +  V                P+ + +GP RC +C K+VGLTGF C+CG+ +C +HRY +KHDC FD++   RDAIA+ANPVVKA+KLD+I
Sbjct:    4 KETGCQQPEG-------PILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAKLAASSIDSIVNGGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGR-EGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDKI 171          
BLAST of DC900077 vs. ExPASy Swiss-Prot
Match: SAP8_ORYSI (Zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Oryza sativa subsp. indica GN=SAP8 PE=2 SV=2)

HSP 1 Score: 147.132 bits (370), Expect = 1.116e-34
Identity = 73/176 (41.48%), Postives = 110/176 (62.50%), Query Frame = 3
Query:  126 KKMGSEQSDGTSYTTSEPKLCVNGCAFFGTAANMGLCSKCYRDLRVKEDQAASAKAAMEKSLNL-KSPKQ--IHQTPELETAKVAAEPFVGXXXXXXXXXXXXVEQPEPQAKGPTRCLSCNKKVGLTGFKCKCGSTFCGIHRYPEKHDCTFDFKVTGRDAIARANPVVKADKLDRI 644
            K+ G +Q +G       P LC+N C FFG+AA M +CSKC++++ +K++QA  A ++++  +N   S K+  I    E+  A+V  +  V                P+ + +GP RC +C K+VGLTGF C+CG+ +C +HRY +KHDC FD++   RDAIA+ANPVVKA+KLD+I
Sbjct:    4 KETGCQQPEG-------PILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAKLAASSIDSIVNGGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGR-EGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANPVVKAEKLDKI 171          
BLAST of DC900077 vs. ExPASy Swiss-Prot
Match: SAP4_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Arabidopsis thaliana GN=SAP4 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.116e-34
Identity = 78/158 (49.37%), Postives = 97/158 (61.39%), Query Frame = 3
Query:  180 KLCVNGCAFFGTAANMGLCSKCYRDLRVKEDQAASAKAAMEKSLN-LKSPKQIHQTPELE--TAKVAAEPFVGXXXXXXXXXXXXVEQPEPQAKGPTRCLSCNKKVGLTGFKCKCGSTFCGIHRYPEKHDCTFDFKVTGRDAIARANPVVKADKLDRI 644
            +LCVN C FFG++A M LCS CY DL +K+ Q AS K+ +E SL+ + +P   +   ELE  T K   E                 EQP P  + P RC  C K+VGLTGF C+CG+TFCG HRYPE H CTFDFK  GR+ IA+ANP+V A KL +I
Sbjct:   14 RLCVNNCGFFGSSATMNLCSNCYGDLCLKQQQQASMKSTVESSLSPVIAPVLENYAAELEIPTTKKTEEK---------KPIQIPTEQPSPPQR-PNRCTVCRKRVGLTGFMCRCGTTFCGSHRYPEVHGCTFDFKSAGREEIAKANPLVIAAKLQKI 161          
BLAST of DC900077 vs. ExPASy Swiss-Prot
Match: SAP3_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 3 OS=Arabidopsis thaliana GN=SAP3 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.486e-34
Identity = 73/171 (42.69%), Postives = 102/171 (59.65%), Query Frame = 3
Query:  174 EPKLCVNGCAFFGTAANMGLCSKCYRDLRVKEDQAASAKAAMEKSLNLKS----------PKQIHQTPELETAK----VAAEPFVGXXXXXXXXXXXXVEQPEPQAKGPTRCLSCNKKVGLTGFKCKCGSTFCGIHRYPEKHDCTFDFKVTGRDAIARANPVVKADKLDRI 644
            EP+LC N C FFG+ A   LCSKC+RDL+ +E  +++AK A+ +SL              P     + E+  AK     AAEP                E+ +   + P RCL+C ++VG+TGF+C+CG  FCG HRY E+H+C+FDFK  G+D IA+ANP+VKADKL++I
Sbjct:    9 EPRLCANNCGFFGSTATQNLCSKCFRDLQHQEQNSSTAKHALTQSLAAVGAAASSSVSPPPPPPADSKEIVEAKSEKRAAAEP----------------EEADGPPQDPKRCLTCRRRVGITGFRCRCGFVFCGTHRYAEQHECSFDFKRMGKDKIAKANPIVKADKLEKI 163          
BLAST of DC900077 vs. ExPASy Swiss-Prot
Match: SAP4_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Oryza sativa subsp. japonica GN=SAP4 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 4.241e-34
Identity = 71/178 (39.89%), Postives = 109/178 (61.24%), Query Frame = 3
Query:  126 KKMGSEQSDGTSYTTSEPKLCVNGCAFFGTAANMGLCSKCYRDLRVKEDQAASAKAAMEKSLNLKSPKQIH-----QTPELETAKVAAEPFVGXXXXXXXXXXXXVEQPEPQAKGPTRCLSCNKKVGLTGFKCKCGSTFCGIHRYPEKHDCTFDFKVTGRDAIARANPVVKADKLDRI 644
            K+ G +Q +G       P LC+N C FFG+AA M +CSKC++++ +KE+QA  A ++++  +N     + H      +  +  A+V A+  V                P+ + +GP RC +C K+VGLTGF C+CG+ +C +HRY +KH+C FD++   RDAIA+ANPVVKA+KLD+I
Sbjct:    4 KEAGCQQPEG-------PILCINNCGFFGSAATMNMCSKCHKEMIMKEEQAKLAASSIDSIVNGCDGGKEHIVAASGSTAVAVAQVEAKTLVVQPTDVAGTSEEVAVVPKVK-EGPNRCATCRKRVGLTGFNCRCGNMYCALHRYSDKHECQFDYRTAARDAIAKANPVVKAEKLDKI 173          
BLAST of DC900077 vs. ExPASy Swiss-Prot
Match: SAP6_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Arabidopsis thaliana GN=SAP6 PE=2 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 6.123e-33
Identity = 70/164 (42.68%), Postives = 98/164 (59.76%), Query Frame = 3
Query:  165 TTSEPKLCVNGCAFFGTAANMGLCSKCYRDLRVKEDQAASA-KAAMEKSLNLKSPKQIHQTPELETAKVAA---EPFVGXXXXXXXXXXXXVEQPEPQAKGPTRCLSCNKKVGLTGFKCKCGSTFCGIHRYPEKHDCTFDFKVTGRDAIARANPVVKADKLDRI 644
            T    +LCVN C F G++A M LCS CY DL +K+ Q +S+ K+ +E SL++  P     + E+ +  +      P V                 + Q + P RC +C K+VGLTGFKC+CG+ FCG+HRYPE H C++DFK  GR+ IA+ANP+VKA KL +I
Sbjct:    9 TPESNRLCVNNCGFLGSSATMNLCSNCYGDLCLKQQQQSSSIKSTVESSLSVSPPSS--SSSEISSPIIPPLLKNPSVKLEVPEKKAVISLPTTEQNQQQRPNRCTTCRKRVGLTGFKCRCGTMFCGVHRYPEIHGCSYDFKSAGREEIAKANPLVKAAKLQKI 170          
The following BLAST results are available for this feature:
BLAST of DC900077 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
SAP1_ARATH2.024e-5259.06Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP7_ARATH1.228e-4955.98Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP9_ARATH2.029e-4453.71Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP2_ARATH7.728e-3646.58Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP8_ORYSJ1.116e-3441.48Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP8_ORYSI1.116e-3441.48Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP4_ARATH1.116e-3449.37Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP3_ARATH2.486e-3442.69Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP4_ORYSJ4.241e-3439.89Zinc finger A20 and AN1 domain-containing stress-a... [more]
SAP6_ARATH6.123e-3342.68Zinc finger A20 and AN1 domain-containing stress-a... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900077 VSS Citrus sinensis cDNA clone VS27Q83 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900077 ID=DC900077|Name=DC900077|organism=Citrus sinensis|type=EST|length=830bp
CCGAAACCAAAACCAGAACCAGCACCGCGGTTCTGCTCCTGCGCTTCCCA
TTTGAAACAGAAGAGATAGATCGCGGCGGGTCCTGCTGTAACAGAGTCCG
AGAAGATCCAAAACCCTAATTCGGAAAAAAGATGGGTTCAGAACAAAGCG
ATGGAACCAGCTACACCACATCTGAGCCAAAGCTCTGCGTCAACGGTTGT
GCCTTCTTCGGCACTGCGGCGAATATGGGCTTATGCTCAAAGTGTTACAG
GGATTTGCGGGTTAAGGAGGACCAAGCTGCCTCCGCAAAAGCCGCTATGG
AGAAATCTCTCAATTTGAAGTCACCGAAGCAAATCCATCAGACGCCAGAA
TTGGAGACTGCCAAGGTGGCTGCTGAGCCCTTTGTGGGTTCCTCGTTGTC
TGCTGCGGCCTCTCAACAGTTGAGTGTTGAGCAGCCTGAGCCCCAAGCCA
AGGGGCCTACCAGGTGCTTGAGTTGCAACAAGAAGGTCGGATTGACAGGG
TTCAAGTGTAAGTGCGGGAGTACTTTCTGTGGAATCCATCGGTACCCAGA
GAAGCATGATTGTACATTTGATTTTAAGGTTACTGGTCGTGACGCTATTG
CCAGAGCAAATCCTGTTGTCAAAGCTGATAAGCTGGACAGGATCTGAAAT
CAGAGTCTGGTAATTTGGAAAAANTTTGGTATGGTAATTGTGTCAGTTGG
GTTATTGTTGATTTAGCTTAGCTTTATTTCCTNCTGTTCTTGTTAGTGTT
GGTCAGGACTTGGGAGGGACTCGTAAATGTAGTTTCCTATCTGCATTGGA
TATACTCTATATAATGCGAAGAATCTTTCC
back to top