DC900073

Overview
NameDC900073
Unique NameDC900073
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length852
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900073_ssr365 microsatellite DC900073_ssr365:365..379. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900073 vs. ExPASy Swiss-Prot
Match: Y1235_ORYSJ (B3 domain-containing protein Os01g0723500 OS=Oryza sativa subsp. japonica GN=Os01g0723500 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.122e-13
Identity = 43/112 (38.39%), Postives = 62/112 (55.36%), Query Frame = 3
Query:   54 GDAAPCFYHIILDGKVPQ---IPQEFLKHISKESSEKA--------TLTVQG-SARSWTVKLSETGIGVFLQDGWLKFLRDNSLGDSEFLLFTYDGNTCFSVQIFNKNGCER 353
            G+  P F+ +++ G   Q   IP  F KHI  E S KA          T++G S R+W V +  T  G F   GW KF++D +L + EF++F YDGNT F+  +F++  CER
Sbjct:   15 GERRPHFFKVLV-GDFKQRLKIPPNFCKHIPWEESRKAKGLKEASMAATLEGPSGRTWLVVIRRTAEGTFFTSGWPKFVQDQALRELEFVVFRYDGNTRFTAMVFDRTACER 125          
BLAST of DC900073 vs. ExPASy Swiss-Prot
Match: Y1237_ORYSJ (B3 domain-containing protein Os03g0120900 OS=Oryza sativa subsp. japonica GN=Os01g0723700 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.371e-11
Identity = 42/98 (42.86%), Postives = 52/98 (53.06%), Query Frame = 3
Query:  105 QIPQEFLKHI----------SKESSEKATLTVQGSARSWTVKLSETGIGVFLQDGWLKFLRDNSLGDSEFLLFTYDGNTCFSVQIFNKNGCERIVAVS 368
            +IPQ FL HI          S  SS K TL      ++W V+L +    VFL  GW KF+ DNSL + EFLLF YD N  F V  F  N CE+++  S
Sbjct:   23 EIPQGFLIHIPEVDHSTFDASLPSSAKGTLQ-NSEGKTWPVELEKLDGHVFLTTGWAKFVEDNSLREYEFLLFRYDDNMHFMVLPFGLNACEKVIRSS 119          
BLAST of DC900073 vs. ExPASy Swiss-Prot
Match: Y5809_ARATH (B3 domain-containing protein At5g18090 OS=Arabidopsis thaliana GN=At5g18090 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.339e-11
Identity = 53/179 (29.61%), Postives = 76/179 (42.46%), Query Frame = 3
Query:  108 IPQEFLKHISKESSEKATLTVQGSARSWTVKLSETGIGVFLQD-GWLKFLRDNSLGDSEFLLFTYDGNTCFSVQIFNKNGCE-----RIVAVSDQIRRNQEFDGFANGTGKDLPSXXXXXXXXXXXXXXXXCMIKSGFNVQASQTRENQDGRPKMKKPAM*FQNKIESVSQNISGDSLS 626
            IP  F+K IS+E      L       SW +K+       F++  GW +FL DN LG+ EFL FT+ GN CF+V I+  +G E     R   ++    RN+      N   KD+                      +G   + S + +      K KK  M    K+ES+S +   DSLS
Sbjct:   35 IPLNFIKSISEEELSAKMLLKVSWGSSWPIKICRNPSFYFMEKKGWDQFLSDNGLGNDEFLTFTHQGNMCFTVDIYQIDGKELLTPRRSATIASSSGRNKREQ--RNNIYKDVKEEEDIESWSESSYPGHKTAESTGRRQRLSLSNKKAKETEKSKKKKM----KVESISYDSQDDSLS 207          
The following BLAST results are available for this feature:
BLAST of DC900073 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
Y1235_ORYSJ1.122e-1338.39B3 domain-containing protein Os01g0723500 OS=Oryza... [more]
Y1237_ORYSJ1.371e-1142.86B3 domain-containing protein Os03g0120900 OS=Oryza... [more]
Y5809_ARATH2.339e-1129.61B3 domain-containing protein At5g18090 OS=Arabidop... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900073 VSS Citrus sinensis cDNA clone VS27Q79 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900073 ID=DC900073|Name=DC900073|organism=Citrus sinensis|type=EST|length=852bp
CTTTGTTATTGTTTTGGCCCAAGAAGTAAATGGAGAAGAAATGGGAGAAT
CAAGGCGATGCAGCGCCATGCTTCTACCATATTATCCTTGACGGAAAAGT
TCCTCAAATACCACAAGAATTCTTGAAGCATATATCAAAGGAATCATCTG
AAAAGGCAACTCTAACAGTTCAAGGCTCTGCTCGTTCATGGACTGTTAAA
CTTAGTGAAACTGGCATTGGAGTTTTTCTTCAGGATGGGTGGCTGAAATT
TCTCAGAGACAACTCTTTAGGTGACTCTGAGTTTTTACTCTTCACGTATG
ATGGAAATACGTGTTTCAGCGTTCAAATCTTCAACAAAAATGGGTGTGAA
AGAATTGTTGCTGTATCAGATCAGATCAGAAGGAATCAAGAATTTGATGG
GTTCGCTAATGGAACAGGTAAAGACCTTCCAAGTCTGAAATCCAATAAGC
CTAAATCTATGCGGAAAAAGAAGAACTTGAACTGCATGATCAAGAGTGGA
TTCAACGTTCAAGCAAGCCAAACAAGAGAGAATCAGGATGGAAGACCGAA
AATGAAGAAACCTGCCATGTAATTTCAGAACAAAATTGAAAGTGTTAGTC
AAAACATTTCAGGTGATTCACTTTCAAAATTAAGTTAAGAGATACAAACG
GGCTTGCAGACCAAAGTTTGATTTATATTTTGTCATTTTGTCAACTCTGC
ATTAGAAGTTTGATTTATATCATCAGTCGTATGCCTCCAAGCAATGTTGT
TAACCTTGGAACAATAGCACTTAAAAGTTAAGCTTAATATTCACTGTTCT
AAATGCTCCAATTGGTGGCATTCCATTCCTCGTATAAAATTGGGTTTCCG
AA
back to top