DC900070

Overview
NameDC900070
Unique NameDC900070
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length877
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5634 contig Csv1_Contig5634:1..876. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_ARATH (Agmatine deiminase OS=Arabidopsis thaliana GN=AIH PE=1 SV=2)

HSP 1 Score: 351.288 bits (900), Expect = 5.551e-101
Identity = 165/208 (79.33%), Postives = 186/208 (89.42%), Query Frame = 2
Query:    2 FPHSMVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            F HSM+LEGGSIHVDGEGTCL TEECLLNKNRNPH++K QIE ELK YLGV   IWLPRGL+GD+DTNGHIDNMCCF++PGVVLLSWTDD+TDPQYERSVEAL++LS++ DARGRK+Q+IKL++P PLYMTEEE++G+ QDGEA PRLAGTRLAASYVNFYIANGGIIAPQFGD   D EA+RVLS  FP + VVGIE AREIVL GG
Sbjct:  155 FQHSMILEGGSIHVDGEGTCLVTEECLLNKNRNPHMSKEQIEEELKKYLGVQSFIWLPRGLYGDEDTNGHIDNMCCFARPGVVLLSWTDDETDPQYERSVEALSVLSNSIDARGRKIQVIKLYIPEPLYMTEEESSGITQDGEAIPRLAGTRLAASYVNFYIANGGIIAPQFGDPIRDKEAIRVLSDTFPHHSVVGIENAREIVLAGG 362          

HSP 2 Score: 36.5798 bits (83), Expect = 5.551e-101
Identity = 15/19 (78.95%), Postives = 17/19 (89.47%), Query Frame = 3
Query:  624 GNIHCITQQQPAIPTNAAK 680
            GNIHCITQQQPA PT+ A+
Sbjct:  362 GNIHCITQQQPAEPTSVAE 380          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEAE (Agmatine deiminase OS=Pseudomonas aeruginosa GN=aguA PE=1 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 8.749e-66
Identity = 118/203 (58.13%), Postives = 151/203 (74.38%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN NRNPHL++ +IE  L+ YL V  IIWLP GL+ +D+T+GH+DN CC+++PG VLL+WTDD+ DP Y R   AL +L ++ DA+GRKL + K+ +PGPLY T+EE  G++    ++PR    RLA SYVNF I NGGIIAP F D K D EA  +L + FP++EVV +   REI+LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNHNRNPHLSQAEIERTLRDYLAVESIIWLPNGLY-NDETDGHVDNFCCYARPGEVLLAWTDDQDDPNYLRCQAALRVLEESRDAKGRKLVVHKMPIPGPLYATQEECDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIIAPSFDDPK-DAEARAILQRVFPEHEVVMVP-GREILLGGG 353          

HSP 2 Score: 30.8018 bits (68), Expect = 8.749e-66
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQQPA
Sbjct:  353 GNIHCITQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEA8 (Agmatine deiminase OS=Pseudomonas aeruginosa (strain LESB58) GN=aguA PE=3 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.940e-65
Identity = 118/203 (58.13%), Postives = 150/203 (73.89%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN NRNPHL++ +IE  L+ YL V  IIWLP GL+ +D+T+GH+DN CC+ +PG VLL+WTDD+ DP Y R   AL +L ++ DA+GRKL + K+ +PGPLY T+EE  G++    ++PR    RLA SYVNF I NGGIIAP F D K D EA  +L + FP++EVV +   REI+LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNHNRNPHLSQAEIERTLRDYLAVESIIWLPNGLY-NDETDGHVDNFCCYVRPGEVLLAWTDDQDDPNYLRCQAALRVLEESRDAKGRKLVVHKMPIPGPLYATQEECDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIIAPSFDDPK-DAEARAILQRVFPEHEVVMVP-GREILLGGG 353          

HSP 2 Score: 30.8018 bits (68), Expect = 1.940e-65
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQQPA
Sbjct:  353 GNIHCITQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEAB (Agmatine deiminase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=aguA PE=3 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 7.314e-65
Identity = 117/203 (57.64%), Postives = 150/203 (73.89%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN NRNPHL++ +IE  L+ YL V  IIWLP GL+ +D+T+GH+DN CC+ +PG VLL+WTDD+ DP Y R   AL +L ++ DA+GRKL + K+ +PGPLY T+EE  G++    ++PR    RLA SYVNF I NGGI+AP F D K D EA  +L + FP++EVV +   REI+LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNHNRNPHLSQVEIERTLRDYLAVDSIIWLPNGLY-NDETDGHVDNFCCYVRPGEVLLAWTDDQDDPNYLRCQAALRVLEESRDAKGRKLVVHKMPIPGPLYATQEECDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIVAPSFDDPK-DAEARAILQRVFPEHEVVMVP-GREILLGGG 353          

HSP 2 Score: 30.8018 bits (68), Expect = 7.314e-65
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQQPA
Sbjct:  353 GNIHCITQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEA7 (Agmatine deiminase OS=Pseudomonas aeruginosa (strain PA7) GN=aguA PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.622e-64
Identity = 117/203 (57.64%), Postives = 150/203 (73.89%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN NRNPHL++ +IE  L+ +L V  IIWLP GL+ +D+T+GH+DN CC+ +PG VLL+WTDD+ DP Y R   AL IL ++ DA+GRKL + K+ +PGPLY T+EE  G++    ++PR    RLA SYVNF I NGGI+AP F D K D EA  +L + FP++EVV +   REI+LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNHNRNPHLSQAEIEGILRDHLAVDSIIWLPNGLY-NDETDGHVDNFCCYVRPGEVLLAWTDDQDDPNYLRCQAALRILEESRDAKGRKLVVHKMPIPGPLYATQEECDGVDIVEGSQPRDPSIRLAGSYVNFLIVNGGIVAPSFDDPK-DAEARAILQRVFPEHEVVMVP-GREILLGGG 353          

HSP 2 Score: 30.8018 bits (68), Expect = 1.622e-64
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQQPA
Sbjct:  353 GNIHCITQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSEU2 (Agmatine deiminase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aguA PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.355e-63
Identity = 117/203 (57.64%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN+NRNPHL + QIE  L  YL V K+IWLP GLF +D+T+GH+DN CC+ +PG VLL+WTDD  DP Y R   AL+IL +  DA+GR   + K+ +PGPL+ TEEE AG++Q   ++ R    RLA SYVNF I NGGIIAP F D   D +A  +L + FP++EVV +   RE++LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNRNRNPHLTREQIETILGDYLAVDKVIWLPEGLF-NDETDGHVDNFCCYIRPGEVLLAWTDDPEDPNYSRCHAALSILENTLDAKGRAFIVHKMPIPGPLFATEEECAGVDQVHGSQERNPSVRLAGSYVNFLIVNGGIIAPSF-DDPMDEKAREILQKLFPEHEVV-MAPGRELLLGGG 353          

HSP 2 Score: 30.0314 bits (66), Expect = 1.355e-63
Identity = 11/12 (91.67%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHC+TQQQPA
Sbjct:  353 GNIHCLTQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_PSESM (Agmatine deiminase OS=Pseudomonas syringae pv. tomato GN=aguA PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.304e-63
Identity = 118/203 (58.13%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   17 VLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            VLEGGSIHVDGEGT +TTEECLLN+NRNPHL + QIE  L  YL V KIIWLP GLF +D+T+GH+DN CC+ +PG VLL+WTDD  DP Y R   AL+IL +  DA+GR   + K+ +PGPL+ TEEE AG++Q   ++ R    RLA SYVNF I NGGIIAP F D   D +A  +L + FP++EVV +   RE++LGGG
Sbjct:  154 VLEGGSIHVDGEGTLITTEECLLNRNRNPHLTREQIEAVLSDYLAVDKIIWLPDGLF-NDETDGHVDNFCCYIRPGEVLLAWTDDPEDPNYPRCHAALSILENTRDAQGRAFIVHKMPIPGPLFATEEECAGVDQVHGSQERNPSVRLAGSYVNFLIVNGGIIAPSF-DDPMDEKAREILQKLFPEHEVV-MAPGRELLLGGG 353          

HSP 2 Score: 30.0314 bits (66), Expect = 2.304e-63
Identity = 11/12 (91.67%), Postives = 12/12 (100.00%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHC+TQQQPA
Sbjct:  353 GNIHCLTQQQPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_YERPS (Putative agmatine deiminase OS=Yersinia pseudotuberculosis GN=aguA PE=3 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 3.005e-63
Identity = 123/204 (60.29%), Postives = 146/204 (71.57%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIH DGEGT LTT ECLLN NRNPHLN+ QIE  L  YLGV   IWL  G++ +D+T+GHIDNMCCF +PG V L WTDD+ DPQY RSV A  +LS+  DA+GRKL+I KL  PGPLY TEEE   +    +A PR AG RLA SYVNF I+N  II P   D + DG+A  +L Q FP Y +VG+  AREI+LGGG
Sbjct:  154 LILEGGSIHTDGEGTLLTTAECLLNPNRNPHLNQAQIEQLLCDYLGVTHFIWLQDGVY-NDETDGHIDNMCCFVRPGEVALHWTDDQQDPQYARSVAAFEVLSNTVDAKGRKLKIWKLPAPGPLYNTEEETFDV-LTSDAVPRTAGERLAGSYVNFLISNQQIIFPLL-DSRTDGQANDLLQQMFPGYAIVGVP-AREILLGGG 353          

HSP 2 Score: 27.7202 bits (60), Expect = 3.005e-63
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ PA
Sbjct:  353 GNIHCITQQIPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_YERPE (Putative agmatine deiminase OS=Yersinia pestis GN=aguA PE=3 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 3.005e-63
Identity = 123/204 (60.29%), Postives = 146/204 (71.57%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIH DGEGT LTT ECLLN NRNPHLN+ QIE  L  YLGV   IWL  G++ +D+T+GHIDNMCCF +PG V L WTDD+ DPQY RSV A  +LS+  DA+GRKL+I KL  PGPLY TEEE   +    +A PR AG RLA SYVNF I+N  II P   D + DG+A  +L Q FP Y +VG+  AREI+LGGG
Sbjct:  154 LILEGGSIHTDGEGTLLTTAECLLNPNRNPHLNQAQIEQLLCDYLGVTHFIWLQDGVY-NDETDGHIDNMCCFVRPGEVALHWTDDQQDPQYARSVAAFEVLSNTVDAKGRKLKIWKLPAPGPLYNTEEETFDV-LTSDAVPRTAGERLAGSYVNFLISNQQIIFPLL-DSRTDGQANDLLQQMFPGYAIVGVP-AREILLGGG 353          

HSP 2 Score: 27.7202 bits (60), Expect = 3.005e-63
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ PA
Sbjct:  353 GNIHCITQQIPA 364          
BLAST of DC900070 vs. ExPASy Swiss-Prot
Match: AGUA_YERP3 (Putative agmatine deiminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aguA PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 3.005e-63
Identity = 123/204 (60.29%), Postives = 146/204 (71.57%), Query Frame = 2
Query:   14 MVLEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKGQIENELKAYLGVMKIIWLPRGLFGDDDTNGHIDNMCCFSKPGVVLLSWTDDKTDPQYERSVEALTILSDATDARGRKLQIIKLHVPGPLYMTEEEAAGLNQDGEAKPRLAGTRLAASYVNFYIANGGIIAPQFGDKKWDGEAVRVLSQAFPKYEVVGIERAREIVLGGG 625
            ++LEGGSIH DGEGT LTT ECLLN NRNPHLN+ QIE  L  YLGV   IWL  G++ +D+T+GHIDNMCCF +PG V L WTDD+ DPQY RSV A  +LS+  DA+GRKL+I KL  PGPLY TEEE   +    +A PR AG RLA SYVNF I+N  II P   D + DG+A  +L Q FP Y +VG+  AREI+LGGG
Sbjct:  154 LILEGGSIHTDGEGTLLTTAECLLNPNRNPHLNQAQIEQLLCDYLGVTHFIWLQDGVY-NDETDGHIDNMCCFVRPGEVALHWTDDQQDPQYARSVAAFEVLSNTVDAKGRKLKIWKLPAPGPLYNTEEETFDV-LTSDAVPRTAGERLAGSYVNFLISNQQIIFPLL-DSRTDGQANDLLQQMFPGYAIVGVP-AREILLGGG 353          

HSP 2 Score: 27.7202 bits (60), Expect = 3.005e-63
Identity = 11/12 (91.67%), Postives = 11/12 (91.67%), Query Frame = 3
Query:  624 GNIHCITQQQPA 659
            GNIHCITQQ PA
Sbjct:  353 GNIHCITQQIPA 364          
The following BLAST results are available for this feature:
BLAST of DC900070 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
AGUA_ARATH5.551e-10179.33Agmatine deiminase OS=Arabidopsis thaliana GN=AIH ... [more]
AGUA_PSEAE8.749e-6658.13Agmatine deiminase OS=Pseudomonas aeruginosa GN=ag... [more]
AGUA_PSEA81.940e-6558.13Agmatine deiminase OS=Pseudomonas aeruginosa (stra... [more]
AGUA_PSEAB7.314e-6557.64Agmatine deiminase OS=Pseudomonas aeruginosa (stra... [more]
AGUA_PSEA71.622e-6457.64Agmatine deiminase OS=Pseudomonas aeruginosa (stra... [more]
AGUA_PSEU21.355e-6357.64Agmatine deiminase OS=Pseudomonas syringae pv. syr... [more]
AGUA_PSESM2.304e-6358.13Agmatine deiminase OS=Pseudomonas syringae pv. tom... [more]
AGUA_YERPS3.005e-6360.29Putative agmatine deiminase OS=Yersinia pseudotube... [more]
AGUA_YERPE3.005e-6360.29Putative agmatine deiminase OS=Yersinia pestis GN=... [more]
AGUA_YERP33.005e-6360.29Putative agmatine deiminase OS=Yersinia pseudotube... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900070 VSS Citrus sinensis cDNA clone VS27Q75 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900070 ID=DC900070|Name=DC900070|organism=Citrus sinensis|type=EST|length=877bp
ATTTCCACATTCTATGGTTCTCGAAGGGGGAAGCATCCATGTGGATGGAG
AAGGTACATGCTTAACTACAGAGGAGTGCCTCTTGAACAAAAACAGGAAC
CCACATTTGAACAAAGGACAAATAGAGAACGAACTTAAGGCATATCTTGG
AGTCATGAAGATTATATGGTTGCCTCGTGGATTATTTGGTGATGATGATA
CTAATGGCCATATTGACAATATGTGCTGTTTTTCAAAGCCTGGTGTGGTG
TTACTGTCTTGGACTGATGATAAAACAGATCCTCAGTACGAACGATCTGT
GGAGGCGTTGACTATTCTCTCTGATGCTACTGATGCCAGAGGTCGGAAAT
TACAAATAATTAAACTTCATGTACCAGGGCCACTTTATATGACAGAAGAA
GAAGCTGCTGGACTTAATCAGGATGGTGAGGCTAAACCAAGACTTGCGGG
TACAAGACTTGCTGCTTCATATGTGAATTTCTACATTGCAAATGGAGGAA
TCATCGCACCACAGTTTGGGGACAAAAAGTGGGACGGTGAAGCTGTTCGT
GTCCTGTCTCAAGCCTTTCCTAAGTATGAAGTGGTAGGAATTGAAAGAGC
AAGGGAAATTGTTTTGGGAGGTGGGAAATATACATTGCATTACTCAACAA
CAACCAGCCATTCCAACAAATGCTGCGAAGCTAGACTGATTAGATACTGA
AATTATAACTGTNAANTCAGAGGCAGCAGCGTTGATCTCCAGATTGAGCA
TGTGTGTTTTTAAGAGGACATAATTTAAGCATTTGACAGTTAGTAGCTCT
GTGGGAATCCTGATGATTGATTGGCAAACACTGTCTTAAATAACATATGA
TAAAGCTTAAGCAAAATCAAAGGAAAA
back to top