CN185868

Overview
NameCN185868
Unique NameCN185868
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length469
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig409 contig Csv1_Contig409:45..513. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185868 vs. ExPASy Swiss-Prot
Match: QCR8_SOLTU (Cytochrome b-c1 complex subunit 8 OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 4.351e-30
Identity = 59/72 (81.94%), Postives = 66/72 (91.67%), Query Frame = 3
Query:   18 MAKQPVRMKAVVYALSPFQQKIMPGLWKDLTGKIHHKVSDNWISTILLLGPLVGTYAYVQNYQEKEKLAHRY 233
            M KQPV++KAVVYA+SPFQQKIMPGLWKDL GKIHHKVS+NWIS  LLLGPLVGTY+YVQ++ EKEKL HRY
Sbjct:    1 MGKQPVKLKAVVYAISPFQQKIMPGLWKDLPGKIHHKVSENWISATLLLGPLVGTYSYVQHFLEKEKLEHRY 72          
The following BLAST results are available for this feature:
BLAST of CN185868 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
QCR8_SOLTU4.351e-3081.94Cytochrome b-c1 complex subunit 8 OS=Solanum tuber... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001P22_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001P22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185868 ID=CN185868|Name=CN185868|organism=Citrus sinensis|type=EST|length=469bp
GAGAGAAATCAAAAGACATGGCAAAGCAGCCGGTGAGAATGAAGGCGGTG
GTGTACGCACTGTCGCCATTTCAACAAAAGATTATGCCGGGGCTTTGGAA
GGATCTGACCGGTAAGATCCATCACAAGGTCTCCGATAATTGGATCAGCA
CTATCCTTTTGCTCGGTCCTCTCGTCGGCACCTACGCGTATGTCCAAAAT
TACCAGGAGAAGGAGAAGTTGGCACACAGGTATTGAAGCAAGCTGATGTG
CCTCTATTTTTTCAGAAGCTTAAGGTTCTTGTGAATTAGCTACAACTCTT
GTTGAAGTTGTGAAACATAATTGAAATTGCTATGTAGTTGAGACTACAGT
AGTTTGATTTGTGGGTTTTGTTGATGGATTGAGAACTATTGTCAAAATTC
TGAGCAATATTTTCTCTTTCTTTTGATGAAATAAATTTGATGCATGGATT
GCTAAAAAAAAAAAAAAAA
back to top