CN185867

Overview
NameCN185867
Unique NameCN185867
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length556
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2614 contig Csv1_Contig2614:147..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185867 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.038e-22
Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = -1
Query:  299 MWDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 496
            M DTCGNCDCAD++QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of CN185867 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 6.965e-19
Identity = 39/64 (60.94%), Postives = 48/64 (75.00%), Query Frame = -1
Query:  296 TCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCGS 487
            TCGNCDC D+SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of CN185867 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 5.896e-18
Identity = 43/65 (66.15%), Postives = 48/65 (73.85%), Query Frame = -1
Query:  302 MWDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 496
            M D CGNCDCAD SQCVKKG+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of CN185867 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.606e-15
Identity = 37/65 (56.92%), Postives = 44/65 (67.69%), Query Frame = -1
Query:  302 MWDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 496
            M   C NCDC+D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of CN185867 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.606e-15
Identity = 37/62 (59.68%), Postives = 44/62 (70.97%), Query Frame = -1
Query:  299 CGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 484
            C NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    5 CDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of CN185867 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.102e-15
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = -1
Query:  299 MWDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 496
            M D CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CN185867 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.102e-15
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = -1
Query:  299 MWDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 496
            M D CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CN185867 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.741e-13
Identity = 32/66 (48.48%), Postives = 40/66 (60.61%), Query Frame = -1
Query:  299 MWDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 496
            M D CGNCDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of CN185867 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.702e-12
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = -1
Query:  299 MWDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 496
            M D CG+CDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of CN185867 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA1.038e-2268.18Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC6.965e-1960.94Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE5.896e-1866.15Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV1.606e-1556.92Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO1.606e-1559.68Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ6.102e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI6.102e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ9.741e-1348.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI3.702e-1246.97Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001P22_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001P22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185867 ID=CN185867|Name=CN185867|organism=Citrus sinensis|type=EST|length=556bp
TTTTTTTTTTTTTTTTTAGACTAACAATAATACATTAAAATTCCCCTACA
CAAGGCCACGGTCATGGCCATGGCCATATATTACCTGATTATGAAGAAGG
AAACACAAAACATTACGAGTGATGGGTGACACAACACGCACATCACTCCA
CACACTAGTAGTAGACCATCATAAAAACGAAGTAGAGAATTTTTCTTTTT
TTTTTTAATCACCCTTACATTATTCTTAACCCCCACAATATTTAGGCACA
CTTGCAGCTTCTTATTTTTTTGCTGCATGTGTTTGCTTATTAGTGACTAC
CACAAGTGCAGTTCACACAAGCGCAGGTGGGGCCGCACTTGCAGTTACCT
TCAGCCTCAGCAGCCTGAACGTCCATGACAACAACGGTGCTGACAAAGCT
CAAGTCAGTCTCGACGAAGTCAGCAGCATAGCTGCTTCCCTTCTTCACAC
ACTGGCTCCTGTCAGCGCAGTCGCAGTTGCCGCAGGTGTCCCACATGTTG
ATTGAGCTTAGAACTTAGAACTTAAAACTGGAAATAGAGGGCTCTTTATT
GTACGA
back to top