DC900065

Overview
NameDC900065
Unique NameDC900065
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length646
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9752 contig Csv1_Contig9752:380..1025. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_SOLSC (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Solenostemon scutellarioides GN=MET PE=1 SV=2)

HSP 1 Score: 301.212 bits (770), Expect = 2.995e-81
Identity = 148/152 (97.37%), Postives = 149/152 (98.03%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PLRKSEHAFYLDWAVHSFRITN GVQDTTQIHTHMCYSNFNDIIHSII+MDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKY EVKPAL NMVAAAKLLRTQLASAK
Sbjct:  613 PLRKSEHAFYLDWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYAEVKPALENMVAAAKLLRTQLASAK 764          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_ARATH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Arabidopsis thaliana GN=CIMS PE=1 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 7.378e-80
Identity = 143/152 (94.08%), Postives = 149/152 (98.03%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PLRKSEHAFYLDWAVHSFRITNCGVQD+TQIHTHMCYS+FNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPS+EEIADR+NKMLAVLE NILWVNPDCGLKTRKYTEVKPAL NMV AAKL+R+QLASAK
Sbjct:  614 PLRKSEHAFYLDWAVHSFRITNCGVQDSTQIHTHMCYSHFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSSEEIADRVNKMLAVLEQNILWVNPDCGLKTRKYTEVKPALKNMVDAAKLIRSQLASAK 765          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_CATRO (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Catharanthus roseus GN=METE PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 3.100e-78
Identity = 141/152 (92.76%), Postives = 147/152 (96.71%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PLRK+EHAFYLDWAVHSFRITN  +QDTTQIHTHMCYSNFNDIIHSIIDMDADV+TIENSRS EKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVL+TNILWVNPDCGLKTRKY EVKPAL NMV+AAKL+RTQLASAK
Sbjct:  614 PLRKAEHAFYLDWAVHSFRITNLPLQDTTQIHTHMCYSNFNDIIHSIIDMDADVMTIENSRSSEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLDTNILWVNPDCGLKTRKYAEVKPALENMVSAAKLIRTQLASAK 765          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_MESCR (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mesembryanthemum crystallinum GN=METE PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 3.789e-76
Identity = 139/152 (91.45%), Postives = 143/152 (94.08%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLASAK 456
            PLRKSEH FYL WAVHSFRITN GVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIP TEE+ADRI KMLAVLE+N+LWVNPDCGLKTRKY EV PALSNMVAAAK LR +LASAK
Sbjct:  614 PLRKSEHDFYLKWAVHSFRITNVGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPPTEELADRIRKMLAVLESNVLWVNPDCGLKTRKYGEVNPALSNMVAAAKQLRQELASAK 765          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURS3 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia sp. (strain 383) GN=metE PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.075e-46
Identity = 96/148 (64.86%), Postives = 108/148 (72.97%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLR+++   YL WAV SFRIT  GVQD TQIHTHMCYS FNDII SI DMDADVITIE SRSD +LL  F +  KY   IGPGVYDIHSP IP+ E I   + K    +    LWVNPDCGLKTR++ EV PAL+NMVAAAK LR Q+
Sbjct:  617 PLRRAQWGEYLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDMELLDAF-DNFKYPNEIGPGVYDIHSPNIPTQEHIVGLMKKAAERIPAERLWVNPDCGLKTRQWAEVIPALTNMVAAAKTLRNQV 763          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURCC (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=metE PE=3 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.404e-46
Identity = 95/148 (64.19%), Postives = 110/148 (74.32%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLR+++ + YL WAV SFRIT  GVQD TQIHTHMCYS FNDII SI DMDADVITIE SRSD +LL  F +  KY   IGPGVYDIHSP IP+ + I   + K    +    LWVNPDCGLKTR++ EV PAL+NMVAAAK+LR Q+
Sbjct:  617 PLRRAQWSEYLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDMELLDAF-DTFKYPNEIGPGVYDIHSPNIPTQDHIVGLMRKAAERIPAERLWVNPDCGLKTRQWAEVIPALTNMVAAAKMLRNQV 763          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURCH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=metE PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.129e-46
Identity = 95/148 (64.19%), Postives = 109/148 (73.65%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLR+++ + YL WAV SFRIT  GVQD TQIHTHMCYS FNDII SI DMDADVITIE SRSD +LL  F +  KY   IGPGVYDIHSP IP+ + I   + K    +    LWVNPDCGLKTR++ EV PAL+NMVAAAK LR Q+
Sbjct:  617 PLRRAQWSEYLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDMELLDAF-DTFKYPNEIGPGVYDIHSPNIPTQDHIVGLMKKAAERIPAERLWVNPDCGLKTRQWAEVIPALTNMVAAAKTLRNQV 763          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURCA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=metE PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.129e-46
Identity = 95/148 (64.19%), Postives = 109/148 (73.65%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLR+++ + YL WAV SFRIT  GVQD TQIHTHMCYS FNDII SI DMDADVITIE SRSD +LL  F +  KY   IGPGVYDIHSP IP+ + I   + K    +    LWVNPDCGLKTR++ EV PAL+NMVAAAK LR Q+
Sbjct:  617 PLRRAQWSEYLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDMELLDAF-DTFKYPNEIGPGVYDIHSPNIPTQDHIVGLMKKAAERIPAERLWVNPDCGLKTRQWAEVIPALTNMVAAAKTLRNQV 763          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_BURCJ (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=metE PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.086e-46
Identity = 95/148 (64.19%), Postives = 109/148 (73.65%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQL 444
            PLR+++ + YL WAV SFRIT  GVQD TQIHTHMCYS FNDII SI DMDADVITIE SRSD +LL  F +  KY   IGPGVYDIHSP IP+ + I   + K    +    LWVNPDCGLKTR++ EV PAL+NMVAAAK LR Q+
Sbjct:  617 PLRRAQWSEYLKWAVESFRITANGVQDDTQIHTHMCYSEFNDIIASIADMDADVITIETSRSDMELLDAF-DDFKYPNEIGPGVYDIHSPNIPTQDHIVGLMRKAAERIPAERLWVNPDCGLKTRQWGEVIPALTNMVAAAKTLRNQV 763          
BLAST of DC900065 vs. ExPASy Swiss-Prot
Match: METE_SACD2 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=metE PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.337e-46
Identity = 92/149 (61.74%), Postives = 109/149 (73.15%), Query Frame = 1
Query:    1 PLRKSEHAFYLDWAVHSFRITNCGVQDTTQIHTHMCYSNFNDIIHSIIDMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYTEVKPALSNMVAAAKLLRTQLA 447
            PLRK +   YLDWAV +F+I+  GV DTTQIHTHMCY+ FNDII +I D+DADVITIE SRS+ +LLS F E   Y   IGPGVYDIHSP IP+TE++   I K    L    LW+NPDCGLKTRK+ +V PAL NMV AAK LR ++A
Sbjct:  618 PLRKKDWQNYLDWAVEAFKISTAGVGDTTQIHTHMCYAEFNDIIQAIADLDADVITIETSRSNMELLSAF-EQFNYPNDIGPGVYDIHSPNIPATEQVVGLIKKAAENLPLQRLWINPDCGLKTRKWEDVIPALENMVNAAKQLRAEVA 765          
The following BLAST results are available for this feature:
BLAST of DC900065 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 274
Match NameE-valueIdentityDescription
METE_SOLSC2.995e-8197.375-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_ARATH7.378e-8094.085-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_CATRO3.100e-7892.765-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_MESCR3.789e-7691.455-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURS31.075e-4664.865-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCC1.404e-4664.195-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCH3.129e-4664.195-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCA3.129e-4664.195-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCJ4.086e-4664.195-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_SACD25.337e-4661.745-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900065 VSS Citrus sinensis cDNA clone VS27Q70 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900065 ID=DC900065|Name=DC900065|organism=Citrus sinensis|type=EST|length=646bp
CCTCTTAGGAAATCTGAGCATGCTTTCTACTTGGACTGGGCAGTCCACTC
CTTCAGAATCACCAACTGTGGCGTCCAGGACACTACCCAGATCCACACCC
ACATGTGCTACTCCAACTTCAACGACATTATCCACTCAATTATCGACATG
GATGCTGATGTGATCACCATTGAGAACTCTCGTTCTGATGAGAAGCTCCT
GTCTGTCTTCCGTGAGGGAGTCAAGTATGGTGCTGGAATTGGCCCTGGTG
TGTATGACATCCACTCTCCAAGAATACCATCAACTGAAGAAATTGCTGAC
AGAATCAACAAGATGCTTGCTGTGCTAGAAACCAACATTTTGTGGGTTAA
CCCTGACTGTGGTCTTAAGACTCGCAAGTACACTGAGGTGAAGCCAGCCC
TCTCAAACATGGTCGCTGCTGCCAAGCTACTCCGCACCCAGCTTGCCAGT
GCCAAGTGAGTGGTTCTGGAGATTGGAGGGATACTTCCTGAGCCATTGAT
TTTTTTTTTTTTCACTTTAAACAAAGAAAGAAAATTCCTGTCTTATTACC
TATTCGAATAACTGTGGGTCGGGATGTGATGAAAATTTTCCGTATGCATA
TTATGCACTATTGAGCAATTGGCTTCTATTTTTCTTTGCTTGTAAA
back to top