DC900060

Overview
NameDC900060
Unique NameDC900060
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length747
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900060 vs. ExPASy Swiss-Prot
Match: CUCM1_CUCME (Cucumisin OS=Cucumis melo PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 9.957e-28
Identity = 71/194 (36.60%), Postives = 110/194 (56.70%), Query Frame = 2
Query:    2 AAFDDAIADGVDIILTGATYGFAFDFAEDAVAIGAFHAMEKGILTAVPTGNMGPKPASTVVVAPWILTVAGSSIDRLFIDKAILGDGTTLVGDAVNPFTMKGNKFPLSYGKTNASYPCSELASRQCSLFCLDENLVKGKILLCDNFRGDVETFRV--GALGSIQPAST-IMSHPTPFPTVILKMEDFERVKLYI 574
            AA+DDAIADGVDII           +  DA+AIG+FHA+E+GILT+   GN GP   +T  ++PW+L+VA S++DR F+ +  +G+G +  G ++N  T     +PL  G+   +    +  SR C+   ++ NL+KGKI++C+   G  E F+   GA G +  ++T   +   P P+ +L   D      YI
Sbjct:  257 AAYDDAIADGVDIISLSVGGANPRHYFVDAIAIGSFHAVERGILTSNSAGNGGPNFFTTASLSPWLLSVAASTMDRKFVTQVQIGNGQSFQGVSIN--TFDNQYYPLVSGRDIPNTGFDKSTSRFCTDKSVNPNLLKGKIVVCEASFGPHEFFKSLDGAAGVLMTSNTRDYADSYPLPSSVLDPNDLLATLRYI 448          

HSP 2 Score: 28.4906 bits (62), Expect = 9.957e-28
Identity = 13/31 (41.94%), Postives = 19/31 (61.29%), Query Frame = 3
Query:  585 KKPQVHILRSMAIKDDAAPVVHXFSGRGPSK 677
            + P   I +S  I + +APVV  FS RGP++
Sbjct:  452 RSPGATIFKSTTILNASAPVVVSFSSRGPNR 482          
BLAST of DC900060 vs. ExPASy Swiss-Prot
Match: XSP1_ARATH (Xylem serine proteinase 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.801e-23
Identity = 61/152 (40.13%), Postives = 83/152 (54.61%), Query Frame = 2
Query:    2 AAFDDAIADGVDIILTGATYGFAFDFAEDAVAIGAFHAMEKGILTAVPTGNMGPKPASTVVVAPWILTVAGSSIDRLFIDKAILGDGTTLVGDAVNPFTMKGNKFPLSYGKTNASYPCSELASRQCSLFCLDENLVKGKILLCDNFRGDVET 457
            A F+ AI DGV+II        A D++ D++++G+FHAM KGILT    GN GP   +     PWILTVA S IDR F  K  LG+G +  G  ++ F+ K   +PL  G   A     +  +R C    LD   VKGK+++C    G VE+
Sbjct:  264 AGFEAAIHDGVEIISISIGGPIA-DYSSDSISVGSFHAMRKGILTVASAGNDGPSSGTVTNHEPWILTVAASGIDRTFKSKIDLGNGKSFSGMGISMFSPKAKSYPLVSGVDAAKNTDDKYLARYCFSDSLDRKKVKGKVMVCRMGGGGVES 414          
BLAST of DC900060 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.771e-17
Identity = 59/154 (38.31%), Postives = 74/154 (48.05%), Query Frame = 2
Query:    2 AAFDDAIADGVDIILTGATYGFAFDFAEDAVAIGAFHAMEKGILTAVPTGNMGPKPASTVVVAPWILTVAGSSIDRLFIDKAILGDGTTLVG----------DAVNPFTMKGNKFPLSYGKTNASYPCSELASRQCSLFCLDENLVKGKILLCD 433
            AA D AIAD V+++      G + D+  D VAIGAF AME+GIL +   GN GP  +S   VAPWI TV   ++DR F   AILG+G    G          D + PF   GN    + G               C    L    VKGKI++CD
Sbjct:  265 AAIDKAIADNVNVLSMSLGGGMS-DYYRDGVAIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFTGVSLFKGEALPDKLLPFIYAGNASNATNGNL-------------CMTGTLIPEKVKGKIVMCD 404          
The following BLAST results are available for this feature:
BLAST of DC900060 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CUCM1_CUCME9.957e-2836.60Cucumisin OS=Cucumis melo PE=1 SV=1[more]
XSP1_ARATH4.801e-2340.13Xylem serine proteinase 1 OS=Arabidopsis thaliana ... [more]
SUBL_ARATH8.771e-1738.31Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900060 VSS Citrus sinensis cDNA clone VS27Q67 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900060 ID=DC900060|Name=DC900060|organism=Citrus sinensis|type=EST|length=747bp
GGCAGCCTTTGATGATGCTATTGCTGACGGGGTTGATATTATTTTAACTG
GAGCAACCTATGGTTTTGCATTCGATTTTGCAGAGGATGCTGTCGCAATT
GGTGCTTTTCATGCAATGGAGAAAGGTATACTCACCGCTGTTCCCACAGG
CAACATGGGTCCAAAACCAGCATCGACAGTTGTGGTTGCTCCATGGATAC
TTACTGTAGCTGGGAGCAGCATAGACCGCCTGTTTATTGACAAGGCTATT
CTGGGGGATGGGACTACTTTGGTTGGTGATGCTGTTAATCCTTTTACGAT
GAAAGGAAATAAATTTCCCTTATCCTATGGAAAGACCAATGCCAGTTATC
CTTGCTCTGAATTGGCTTCCAGGCAATGCTCACTATTTTGCTTGGACGAA
AATCTAGTGAAGGGAAAGATCCTGCTATGTGATAATTTCAGAGGAGATGT
AGAAACTTTCAGAGTTGGTGCTCTTGGGTCAATCCAACCAGCATCTACTA
TAATGTCGCATCCAACTCCATTTCCGACAGTCATATTAAAGATGGAGGAC
TTTGAAAGGGTCAAGCTTTACATAAACTCCACAGAAAAAACCTCAAGTAC
ACATACTGAGAAGCATGGCTATAAAAGATGATGCCGCTCCTGTTGTGCAT
NCATTCTCTGGACGTGGGCCTAGTAAATTACNCCGGATTCATTAAGCCAG
ATTTAAGTGCNCCCCAGTCAATCTGGCAGCATATACCGGGGGTTGGG
back to top