CN185849
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN185849 vs. ExPASy Swiss-Prot
Match: TXD17_DANRE (Thioredoxin domain-containing protein 17 OS=Danio rerio GN=txndc17 PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.842e-12 Identity = 36/80 (45.00%), Postives = 45/80 (56.25%), Query Frame = 1 Query: 103 KNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKTLEASPDDIALLQAYVGDRPTWRNPQHPFRVNSRFKLTGVPTLFRW 342 K K F F DKD SWCPDCV+AEPV+ L P+ + VGDRP W++ + F+ KLTGVPTL R+ Sbjct: 23 KGKEIFAYFSGDKDEHGK-SWCPDCVKAEPVVRAELPHLPEGTVFIYCQVGDRPYWKDSNNDFK--KTLKLTGVPTLLRY 99
BLAST of CN185849 vs. ExPASy Swiss-Prot
Match: TXD17_MOUSE (Thioredoxin domain-containing protein 17 OS=Mus musculus GN=Txndc17 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 7.630e-12 Identity = 39/99 (39.39%), Postives = 56/99 (56.57%), Query Frame = 1 Query: 46 DATVSSFDNVFDKFKSEAPKNKANFILFLADKDPSTSLSWCPDCVRAEPVIYKTLEASPDDIALLQAYVGDRPTWRNPQHPFRVNSRFKLTGVPTLFRW 342 + +V F+ FDK E + K F F KD + SWCPDCV AEPVI + L+ +D + VGD+P W++P + FR + K+T VPTL ++ Sbjct: 6 EVSVLGFEE-FDKAVKEH-EGKTIFAYFSGSKD-TEGKSWCPDCVEAEPVIREGLKHVTEDCVFIYCQVGDKPYWKDPNNDFR--QKLKITAVPTLLKY 99 The following BLAST results are available for this feature:
BLAST of CN185849 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN185849 ID=CN185849; Name=CN185849; organism=Citrus sinensis; type=EST; length=608bpback to top |