DC900055

Overview
NameDC900055
Unique NameDC900055
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1102
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig161 contig Csv1_Contig161:85..1186. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900055 vs. ExPASy Swiss-Prot
Match: ATPO_IPOBA (ATP synthase subunit O, mitochondrial OS=Ipomoea batatas PE=1 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 2.880e-66
Identity = 140/244 (57.38%), Postives = 170/244 (69.67%), Query Frame = 1
Query:   34 MATVSRIRS-SLSVFNKIL----RSNSQLSPLHPQLS-----KGFSTSSLXKEQKVKVPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPSILGGLVVEFGQKVFDMSIKSRARQMERFLREPIHF 735
            MA   R RS   S+  K L    RSN+  S L P LS     + ++T+S  KEQK+KVPL ++G SGNYASALY+AAVK+N LEKVESE+ DLVEASKK+ T+ QF +D SVP +TRVNAI EIC QAKF D T++FL++LAENGRL+++D I KRF ELTMAH+GEVK TVT+VI                              DP+ILGGLVVEFGQKVFDMSI++RARQMERFLREP++F
Sbjct:    1 MAMTGRARSMGFSILQKALSSAQRSNAHRSILCPTLSNSELLRNYATASASKEQKIKVPLTMYGVSGNYASALYLAAVKSNTLEKVESELYDLVEASKKSPTFSQFMRDPSVPVDTRVNAIKEICAQAKFGDTTQNFLLILAENGRLKHIDRIVKRFKELTMAHRGEVKATVTTVIPLPADEEKELKATLQEMVGQGKSVQIEQKIDPTILGGLVVEFGQKVFDMSIRTRARQMERFLREPLNF 244          
BLAST of DC900055 vs. ExPASy Swiss-Prot
Match: ATPO_ARATH (ATP synthase subunit O, mitochondrial OS=Arabidopsis thaliana GN=At5g13450 PE=1 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 2.004e-51
Identity = 114/237 (48.10%), Postives = 153/237 (64.56%), Query Frame = 1
Query:   46 SRIRSSLSVFNKILRSNSQLS----PLHPQLSKGFSTSSLXKEQKVKVPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPSILGGLVVEFGQKVFDMSIKSRARQMERFLREPIHFGTL 744
            +R RS +S F  I  ++S  S     L P L + ++T+S      VKVP+AL G +GN+AS LYIAAVK N+LEK+E+++ +++EA K A  + QFTKD SVP  TR+ AI + C QAKF++ TK+FL +LAENG+L+NLD I K+F++LT AH+G+VKV VT+VI                              DPSI GGL+VEF QKV DMSI++RA+QMER LREP+ F  L
Sbjct:    3 NRFRSGISFFKTIAVTDSVSSVRSKSLFPAL-RTYATASAQTTANVKVPIALVGENGNFASWLYIAAVKMNSLEKIETDLSEMIEAMKTAPIFAQFTKDPSVPRGTRLAAIRDACDQAKFAEPTKNFLSLLAENGKLKNLDAIVKKFMQLTNAHRGDVKVLVTTVIPLPPAEEKELTETLQEIIGAGKKITVEQKIDPSIYGGLIVEFQQKVLDMSIRTRAQQMERLLREPVDFNNL 238          
BLAST of DC900055 vs. ExPASy Swiss-Prot
Match: ATPO_PONAB (ATP synthase subunit O, mitochondrial OS=Pongo abelii GN=ATP5O PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 3.938e-23
Identity = 67/197 (34.01%), Postives = 101/197 (51.27%), Query Frame = 1
Query:  136 FSTSSLXKEQK-VKVPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPSILGGLVVEFGQKVFDMSIKSRARQMERFLRE 723
            FSTS +    K V+ P+ ++G  G YA+ALY AA K N LE+VE E+L + +  K+            V    +V ++N+I  + +FS +T + + +LAENGRL N   +   F  +  AH+GEV  TVTS                                DPSILGG++V  G+K  DMS+K++ +++ R +RE
Sbjct:   16 FSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAAPVLNPY-VKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSAHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLSRAMRE 211          
BLAST of DC900055 vs. ExPASy Swiss-Prot
Match: ATPO_HUMAN (ATP synthase subunit O, mitochondrial OS=Homo sapiens GN=ATP5O PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.496e-22
Identity = 66/197 (33.50%), Postives = 100/197 (50.76%), Query Frame = 1
Query:  136 FSTSSLXKEQK-VKVPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPSILGGLVVEFGQKVFDMSIKSRARQMERFLRE 723
            FSTS +    K V+ P+ ++G  G YA+ALY AA K N LE+VE E+L + +  K+            V    +V ++N+I  + +FS +T + + +LAENGRL N   +   F  +   H+GEV  TVTS                                DPSILGG++V  G+K  DMS+K++ +++ R +RE
Sbjct:   16 FSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPY-VKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMRE 211          
BLAST of DC900055 vs. ExPASy Swiss-Prot
Match: ATPO_RHIFE (ATP synthase subunit O, mitochondrial OS=Rhinolophus ferrumequinum GN=ATP5O PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 7.426e-22
Identity = 62/197 (31.47%), Postives = 100/197 (50.76%), Query Frame = 1
Query:  136 FSTSSLXKEQK-VKVPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPSILGGLVVEFGQKVFDMSIKSRARQMERFLRE 723
            FSTS +    K V+ P+ ++G  G YA+ALY AA K N LE+VE E+L + +  K+            +    +V ++N++ T+ KFS +T + + +LAENGRL N   +   F  +   H+GEV  +VT+                                DPSI+GG+++  G+K  DMS K++ +++ R +RE
Sbjct:   16 FSTSVVRPFTKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVAQLLKEPKMAASIMNPY-IKRSIKVKSLNDMTTKEKFSPLTSNLMNLLAENGRLNNTPGVISAFSTIMSVHRGEVPCSVTTASPLDEATLSELKTVLQSFLSKNQILKLEVKTDPSIMGGMIIRIGEKYVDMSAKTKIQKLSRVMRE 211          
BLAST of DC900055 vs. ExPASy Swiss-Prot
Match: ATPO_BOVIN (ATP synthase subunit O, mitochondrial OS=Bos taurus GN=ATP5O PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 3.685e-21
Identity = 63/197 (31.98%), Postives = 99/197 (50.25%), Query Frame = 1
Query:  136 FSTSSLXKEQK-VKVPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPSILGGLVVEFGQKVFDMSIKSRARQMERFLRE 723
            FSTS +    K V+ P+ ++G  G YA+ALY AA K N LE+VE E+L + +  K+            V    +V +++++  + KFS +T + + +LAENGRL N   +   F  +   H+GEV  TVT+                                DPSI+GG++V  G+K  DMS K++ +++ R +RE
Sbjct:   16 FSTSVVRPFAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPY-VKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTVTTASALDEATLTELKTVLKSFLSKGQVLKLEVKIDPSIMGGMIVRIGEKYVDMSAKTKIQKLSRAMRE 211          
BLAST of DC900055 vs. ExPASy Swiss-Prot
Match: ATPO_MOUSE (ATP synthase subunit O, mitochondrial OS=Mus musculus GN=Atp5o PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.829e-20
Identity = 63/199 (31.66%), Postives = 98/199 (49.25%), Query Frame = 1
Query:  130 KGFSTSSLXKEQK-VKVPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPSILGGLVVEFGQKVFDMSIKSRARQMERFLRE 723
            + FSTS +    K V+ P+ ++G  G YA+ALY AA K   L++VE E+L + +  K             +    +V ++N+I  + KFS +T + + +LAENGRL N   I   F  +   H+GEV  TVT+                                DPSI+GG++V  G+K  DMS KS+ +++ + +RE
Sbjct:   14 RSFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKEKKLDQVEKELLRVGQLLKDPKVSLAVLNPY-IKRTVKVKSLNDITKREKFSPLTANLMNLLAENGRLGNTQGIISAFSTIMSVHRGEVPCTVTTASPLDDAVLSELKTVLKSFLSPNQILKLEIKTDPSIMGGMIVRIGEKYVDMSAKSKIQKLSKAMRE 211          
BLAST of DC900055 vs. ExPASy Swiss-Prot
Match: ATPO_RAT (ATP synthase subunit O, mitochondrial OS=Rattus norvegicus GN=Atp5o PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.389e-20
Identity = 61/199 (30.65%), Postives = 98/199 (49.25%), Query Frame = 1
Query:  130 KGFSTSSLXKEQK-VKVPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPSILGGLVVEFGQKVFDMSIKSRARQMERFLRE 723
            + FSTS +    K V+ P+ ++G  G YA+ALY AA K   L++VE E+L + +  K             +    +V ++ +I T+ KFS +T + + +LAENGRL N   +   F  +   H+GEV  TVT+                                DPSI+GG++V  G+K  DMS KS+ +++ + +R+
Sbjct:   14 RSFSTSVVRPFSKLVRPPVQVYGIEGRYATALYSAASKQKRLDQVEKELLRVGQLLKDPKVSLAVLNPY-IKRSIKVKSLKDITTKEKFSPLTANLMNLLAENGRLGNTQGVISAFSTIMSVHRGEVPCTVTTAFPLDEAVLSELKTVLNSFLSKGQILNLEVKTDPSIMGGMIVRIGEKYVDMSAKSKIQKLSKAMRD 211          
BLAST of DC900055 vs. ExPASy Swiss-Prot
Match: ATPO_PIG (ATP synthase subunit O, mitochondrial OS=Sus scrofa GN=ATP5O PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.389e-20
Identity = 61/197 (30.96%), Postives = 99/197 (50.25%), Query Frame = 1
Query:  136 FSTSSLXKEQK-VKVPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPSILGGLVVEFGQKVFDMSIKSRARQMERFLRE 723
            FSTS +    K V+ P+ ++G  G YA+ALY AA K N LE+VE E+L + +  K+            V    +V +++++  + KFS +T + + +LAENGRL +   +   F  +   H+GEV  +VT+                                DPSI+GG++V  G+K  DMS K++ +++ R +RE
Sbjct:   16 FSTSVVRPFAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASIMNPY-VKRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLSSTPGVISAFSTMMSVHRGEVPCSVTTASPLDEATLTELKTVLKSFLSKGQILKLEVKVDPSIMGGMIVRIGEKYVDMSAKTKIQKLSRAMRE 211          
BLAST of DC900055 vs. ExPASy Swiss-Prot
Match: ATPO_CALMO (ATP synthase subunit O, mitochondrial OS=Callicebus moloch GN=ATP5O PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.120e-20
Identity = 61/199 (30.65%), Postives = 99/199 (49.75%), Query Frame = 1
Query:  136 FSTSSLXKEQK-VKVPLALFGGSGNYASALYIAAVKTNALEKVESEILDLVEASKKADTYFQFTKDLSVPAETRVNAINEICTQAKFSDVTKHFLVVLAENGRLRNLDTIAKRFVELTMAHKGEVKVTVTSVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPSILGGLVVEFGQKVFDMSIKSRARQMERFLREPI 729
            FSTS +    K V+ P+ ++G  G YA+ALY AA K   LE+VE E+L + +  K+            V    +V ++++I  + +FS +T + + +LAENGRL N   +   F  +   H+GE+  TVT+                                DPSI+GG++V  G+K  DMS K++ +++ + +RE I
Sbjct:   16 FSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQKKLEQVEKELLRVAQILKEPKVAASVLNPY-VKHSVKVKSLSDIIAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEIPCTVTTASPLEETTLSELKTVLKSFLSQGQILKLEVKTDPSIMGGMIVRIGEKYVDMSAKTKIQKLSKAMREVI 213          
The following BLAST results are available for this feature:
BLAST of DC900055 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
ATPO_IPOBA2.880e-6657.38ATP synthase subunit O, mitochondrial OS=Ipomoea b... [more]
ATPO_ARATH2.004e-5148.10ATP synthase subunit O, mitochondrial OS=Arabidops... [more]
ATPO_PONAB3.938e-2334.01ATP synthase subunit O, mitochondrial OS=Pongo abe... [more]
ATPO_HUMAN1.496e-2233.50ATP synthase subunit O, mitochondrial OS=Homo sapi... [more]
ATPO_RHIFE7.426e-2231.47ATP synthase subunit O, mitochondrial OS=Rhinoloph... [more]
ATPO_BOVIN3.685e-2131.98ATP synthase subunit O, mitochondrial OS=Bos tauru... [more]
ATPO_MOUSE1.829e-2031.66ATP synthase subunit O, mitochondrial OS=Mus muscu... [more]
ATPO_RAT2.389e-2030.65ATP synthase subunit O, mitochondrial OS=Rattus no... [more]
ATPO_PIG2.389e-2030.96ATP synthase subunit O, mitochondrial OS=Sus scrof... [more]
ATPO_CALMO3.120e-2030.65ATP synthase subunit O, mitochondrial OS=Callicebu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900055 VSS Citrus sinensis cDNA clone VS27Q62 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900055 ID=DC900055|Name=DC900055|organism=Citrus sinensis|type=EST|length=1102bp
AACTGGGCAGATTAGGGTTTTTAAATTTAGGACATGGCAACGGTAAGTCG
TATCAGATCGAGCCTCTCTGTATTCAACAAGATTCTCAGATCCAATTCTC
AGCTATCCCCTCTTCATCCACAGTTATCGAAAGGTTTTTCCACTTCGTCG
TTGCANAAGGAGCAGAAAGTTAAGGTGCCCCTGGCTTTGTTTGGAGGTTC
AGGAAATTATGCTTCTGCTCTGTACATTGCGGCAGTGAAAACTAACGCAC
TGGAGAAGGTTGAGTCTGAGATTCTTGACCTTGTTGAGGCTTCAAAGAAG
GCTGATACATATTTTCAGTTCACAAAGGACTTGTCTGTGCCTGCAGAGAC
GAGAGTTAATGCCATTAACGAAATCTGTACTCAGGCTAAATTTTCAGATG
TTACGAAGCACTTCTTGGTTGTTTTGGCTGAGAATGGGAGGCTTAGAAAC
TTAGACACCATCGCTAAGAGGTTTGTGGAGTTAACCATGGCACACAAGGG
CGAAGTAAAAGTTACTGTTACATCCGTTATTCCACTTCCCCCAGAAGAAG
AGAAAGAGTTGAAAGAGACACTGCAAGAGACACTTGGCCAAGGGAAGAAA
GTCAAGGTTGAACAGAAGGGTGATCCTAGCATTCTTGGTGGGCTCGTAGT
AGAGTTTGGGCAAAAGGTGTTTGACATGTCCATTAAGTCTAGGGCGCGGC
AGATGGAGAGGTTCCTACGTGAGCCCATTCATTTTGGCACCCTCTAAAAA
GGCTGCCACAGCCCCAGGGCCCAAATTTTCAAGATGATTATGCAACAACT
GGAACGCTCCAAGAAGTAAAAGAACCATTCATGCTTTTGTTTGGTGCTGT
TTGCTTGTGCTCCGCCATTTCTGAATGAATTGAATCATTGGCAAAATAAA
ATTCACATCTTGATCACTTTGCTTTCATGGCAAATGGTTCTGATGGACGG
CAACATTTTTTGTTTGGGTTTCGGTTCGGACCATTATCTTTTAAGGGTAT
AATTTGTGTGTTCAAATAATTACTCGGTCCTGCACATGATACGGTTCTTA
AGGACAAAAGCTCTTTTGATGAACATAGTGTTGCTAAGACAGTGTTCGCA
TT
back to top