DC900038

Overview
NameDC900038
Unique NameDC900038
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length536
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900038 vs. ExPASy Swiss-Prot
Match: AGL15_ARATH (Agamous-like MADS-box protein AGL15 OS=Arabidopsis thaliana GN=AGL15 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.989e-16
Identity = 47/99 (47.47%), Postives = 65/99 (65.66%), Query Frame = 3
Query:   90 QSRVQEQRAMLENETLRRQVEELRGFFPPTECSVPAYLEYYPLGRKNSLMNHSSASPDVASDGAVEKGDSDTTLHLGLPSNLYHKR-KAPERETNSNDS 383
            +SR++EQRA LENETLRRQV+ELR F P     VP+Y++ + +  KN+L+NH S         +++  DSDTTL LGLP   + +R    ERE+ S+DS
Sbjct:  145 ESRLKEQRAELENETLRRQVQELRSFLPSFTHYVPSYIKCFAIDPKNALINHDSKC-------SLQNTDSDTTLQLGLPGEAHDRRTNEGERESPSSDS 236          
BLAST of DC900038 vs. ExPASy Swiss-Prot
Match: AGL15_BRANA (Agamous-like MADS-box protein AGL15 OS=Brassica napus GN=AGL15 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 6.890e-13
Identity = 44/100 (44.00%), Postives = 67/100 (67.00%), Query Frame = 3
Query:   90 QSRVQEQRAMLENETLRRQVEELRGFFPP-TECSVPAYLEYYPLGRKNSLMNHSSASPDVASDGAVEKGDSDTTLHLGLPSNLYHKRK-APERETNSNDS 383
            +SR++EQRA LENETLRRQV+ELR F P   +   P+Y+  + +  KNSL++++    D+  + +++  +SDTTL LGLP   +  RK   +RE+ S+DS
Sbjct:  152 ESRLKEQRAELENETLRRQVQELRSFLPSINQHYAPSYIRCFAIDPKNSLLSNTCLG-DI--NCSLQNTNSDTTLQLGLPGEAHDTRKNEGDRESPSSDS 248          
The following BLAST results are available for this feature:
BLAST of DC900038 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
AGL15_ARATH2.989e-1647.47Agamous-like MADS-box protein AGL15 OS=Arabidopsis... [more]
AGL15_BRANA6.890e-1344.00Agamous-like MADS-box protein AGL15 OS=Brassica na... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900038 VSS Citrus sinensis cDNA clone VS27Q46 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900038 ID=DC900038|Name=DC900038|organism=Citrus sinensis|type=EST|length=536bp
AAGAGTTGCAGCTCCTCGAACAGGATCTAAATGAAGGGTTGTTGTTGGTG
AAGGAAAAAAAGGAGAAATTACTGATGGAGCAACTGGAGCAATCAAGGGT
ACAGGAACAGAGGGCTATGCTGGAGAATGAAACTTTGCGTAGACAGGTTG
AGGAACTTCGAGGTTTCTTTCCACCCACTGAATGCTCAGTCCCAGCATAC
CTCGAGTACTATCCTTTAGGAAGGAAGAATTCTCTTATGAACCACAGTTC
TGCAAGCCCTGATGTTGCCTCTGATGGCGCAGTTGAGAAAGGAGATTCGG
ACACTACCCTGCATTTAGGACTGCCTAGCAATCTTTACCACAAGAGGAAG
GCACCTGAAAGGGAAACCAATTCGAATGACTCCAGGAGCCAATTGGGCGT
GCTGTGATACTTTGCTGCTTCGAGGTTCTGCTTTGCTTTGGATAGAAACA
ACAGAAATGAAATGGTTTTTTCACAGTTTAGCAGTTTTCTGAACCAAAAA
GTTTGGCTGAAAGTGCAAAATCATGATAGTGGCGGT
back to top