DC900033

Overview
NameDC900033
Unique NameDC900033
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length587
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900033 vs. ExPASy Swiss-Prot
Match: KCAB_ORYSJ (Probable voltage-gated potassium channel subunit beta OS=Oryza sativa subsp. japonica GN=KOB1 PE=1 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 7.369e-86
Identity = 146/171 (85.38%), Postives = 161/171 (94.15%), Query Frame = 3
Query:   75 HLGRSGLRVSQLAYGAWVSFGNQLDVXEAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVSTKIFWGGQGPNDKGLSRKHIVEGTKASLKRLDMDYVDVIYCHRPDTSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGIAERLDLVGPI 587
            +LGRSGLRVSQL+YGAWV+FGNQLDV EAK+LLQ CRD GVNFFDNAEVYANGRAEEIMGQA+R+LGW+RSD+VVSTK+FWGGQGPNDKGLSRKHIVEG + SLKRLDMDYVDV+YCHRPD +TP+EETVRAMN+VID G AFYWGTSEWSAQQITEAW +A RLDLVGPI
Sbjct:    5 NLGRSGLRVSQLSYGAWVTFGNQLDVKEAKALLQACRDAGVNFFDNAEVYANGRAEEIMGQAMRDLGWRRSDVVVSTKLFWGGQGPNDKGLSRKHIVEGLRGSLKRLDMDYVDVVYCHRPDATTPVEETVRAMNWVIDHGMAFYWGTSEWSAQQITEAWSVANRLDLVGPI 175          
BLAST of DC900033 vs. ExPASy Swiss-Prot
Match: KCAB2_XENLA (Voltage-gated potassium channel subunit beta-2 OS=Xenopus laevis GN=kcnab2 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.499e-54
Identity = 94/171 (54.97%), Postives = 132/171 (77.19%), Query Frame = 3
Query:   75 HLGRSGLRVSQLAYGAWVSFGNQLDVXEAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVSTKIFWGGQGPNDKGLSRKHIVEGTKASLKRLDMDYVDVIYCHRPDTSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGIAERLDLVGPI 587
            +LG+SGLRVS L  G WV+FG Q+    A+ L+    D+G+N FD AEVYA G+AE ++G  I++ GW+RS +V++TKIFWGG+   ++GLSRKHI+EG KASL+RL +DYVDV++ +RPD +TP+EETVRAM +VI++G A YWGTS WS+ +I EA+ +A + +L+ PI
Sbjct:   41 NLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLDYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPI 211          
BLAST of DC900033 vs. ExPASy Swiss-Prot
Match: KCAB2_BOVIN (Voltage-gated potassium channel subunit beta-2 OS=Bos taurus GN=KCNAB2 PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 4.360e-54
Identity = 93/171 (54.39%), Postives = 132/171 (77.19%), Query Frame = 3
Query:   75 HLGRSGLRVSQLAYGAWVSFGNQLDVXEAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVSTKIFWGGQGPNDKGLSRKHIVEGTKASLKRLDMDYVDVIYCHRPDTSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGIAERLDLVGPI 587
            +LG+SGLRVS L  G WV+FG Q+    A+ L+    D+G+N FD AEVYA G+AE ++G  I++ GW+RS +V++TKIFWGG+   ++GLSRKHI+EG KASL+RL ++YVDV++ +RPD +TP+EETVRAM +VI++G A YWGTS WS+ +I EA+ +A + +L+ PI
Sbjct:   41 NLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPI 211          
BLAST of DC900033 vs. ExPASy Swiss-Prot
Match: KCAB2_RAT (Voltage-gated potassium channel subunit beta-2 OS=Rattus norvegicus GN=Kcnab2 PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.695e-54
Identity = 93/171 (54.39%), Postives = 132/171 (77.19%), Query Frame = 3
Query:   75 HLGRSGLRVSQLAYGAWVSFGNQLDVXEAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVSTKIFWGGQGPNDKGLSRKHIVEGTKASLKRLDMDYVDVIYCHRPDTSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGIAERLDLVGPI 587
            +LG+SGLRVS L  G WV+FG Q+    A+ L+    D+G+N FD AEVYA G+AE ++G  I++ GW+RS +V++TKIFWGG+   ++GLSRKHI+EG KASL+RL ++YVDV++ +RPD +TP+EETVRAM +VI++G A YWGTS WS+ +I EA+ +A + +L+ PI
Sbjct:   41 NLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPI 211          
BLAST of DC900033 vs. ExPASy Swiss-Prot
Match: KCAB2_MOUSE (Voltage-gated potassium channel subunit beta-2 OS=Mus musculus GN=Kcnab2 PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.695e-54
Identity = 93/171 (54.39%), Postives = 132/171 (77.19%), Query Frame = 3
Query:   75 HLGRSGLRVSQLAYGAWVSFGNQLDVXEAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVSTKIFWGGQGPNDKGLSRKHIVEGTKASLKRLDMDYVDVIYCHRPDTSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGIAERLDLVGPI 587
            +LG+SGLRVS L  G WV+FG Q+    A+ L+    D+G+N FD AEVYA G+AE ++G  I++ GW+RS +V++TKIFWGG+   ++GLSRKHI+EG KASL+RL ++YVDV++ +RPD +TP+EETVRAM +VI++G A YWGTS WS+ +I EA+ +A + +L+ PI
Sbjct:   41 NLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPI 211          
BLAST of DC900033 vs. ExPASy Swiss-Prot
Match: KCAB2_HUMAN (Voltage-gated potassium channel subunit beta-2 OS=Homo sapiens GN=KCNAB2 PE=1 SV=2)

HSP 1 Score: 209.534 bits (532), Expect = 9.714e-54
Identity = 93/171 (54.39%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   75 HLGRSGLRVSQLAYGAWVSFGNQLDVXEAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVSTKIFWGGQGPNDKGLSRKHIVEGTKASLKRLDMDYVDVIYCHRPDTSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGIAERLDLVGPI 587
            +LG+SGLRVS L  G WV+FG Q+    A+ L+    D+G+N FD AEVYA G+AE ++G  I++ GW+RS +V++TKIFWGG+   ++GLSRKHI+EG KASL+RL ++YVDV++ +RPD +TP+EETVRAM +VI++G A YWGTS WS+ +I EA+ +A + +L  PI
Sbjct:   41 NLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPPI 211          
BLAST of DC900033 vs. ExPASy Swiss-Prot
Match: KCAB1_CHICK (Voltage-gated potassium channel subunit beta-1 OS=Gallus gallus GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 3.125e-52
Identity = 89/171 (52.05%), Postives = 130/171 (76.02%), Query Frame = 3
Query:   75 HLGRSGLRVSQLAYGAWVSFGNQLDVXEAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVSTKIFWGGQGPNDKGLSRKHIVEGTKASLKRLDMDYVDVIYCHRPDTSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGIAERLDLVGPI 587
            +LG+SGLRVS L  G WV+FG Q+    A+ L+    + GVN FD AEVYA G+AE I+G  +++ GW+RS +V++TK++WGG+   ++GLSRKHI+EG +ASL+RL ++YVDV++ +RPD +TP+EE VRAM +VI++G A YWGTS WSA +I EA+ +A + +L+ P+
Sbjct:   75 NLGKSGLRVSCLGLGTWVTFGGQISDEVAEQLMTIAYESGVNLFDTAEVYAAGKAEVILGNILKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLRASLQRLQLEYVDVVFANRPDNNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNLIPPV 245          
BLAST of DC900033 vs. ExPASy Swiss-Prot
Match: KCAB1_RAT (Voltage-gated potassium channel subunit beta-1 OS=Rattus norvegicus GN=Kcnab1 PE=1 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.081e-52
Identity = 89/171 (52.05%), Postives = 130/171 (76.02%), Query Frame = 3
Query:   75 HLGRSGLRVSQLAYGAWVSFGNQLDVXEAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVSTKIFWGGQGPNDKGLSRKHIVEGTKASLKRLDMDYVDVIYCHRPDTSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGIAERLDLVGPI 587
            +LG+SGLRVS L  G WV+FG Q+    A+ L+    + GVN FD AEVYA G+AE I+G  I++ GW+RS +V++TK++WGG+   ++GLSRKHI+EG K SL+RL ++YVDV++ +RPD++TP+EE VRAM +VI++G A YWGTS WSA +I EA+ +A + +++ P+
Sbjct:   75 NLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPV 245          
BLAST of DC900033 vs. ExPASy Swiss-Prot
Match: KCAB1_RABIT (Voltage-gated potassium channel subunit beta-1 OS=Oryctolagus cuniculus GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.081e-52
Identity = 89/171 (52.05%), Postives = 130/171 (76.02%), Query Frame = 3
Query:   75 HLGRSGLRVSQLAYGAWVSFGNQLDVXEAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVSTKIFWGGQGPNDKGLSRKHIVEGTKASLKRLDMDYVDVIYCHRPDTSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGIAERLDLVGPI 587
            +LG+SGLRVS L  G WV+FG Q+    A+ L+    + GVN FD AEVYA G+AE I+G  I++ GW+RS +V++TK++WGG+   ++GLSRKHI+EG K SL+RL ++YVDV++ +RPD++TP+EE VRAM +VI++G A YWGTS WSA +I EA+ +A + +++ P+
Sbjct:   93 NLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPV 263          
BLAST of DC900033 vs. ExPASy Swiss-Prot
Match: KCAB1_MUSPU (Voltage-gated potassium channel subunit beta-1 OS=Mustela putorius GN=KCNAB1 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.081e-52
Identity = 89/171 (52.05%), Postives = 130/171 (76.02%), Query Frame = 3
Query:   75 HLGRSGLRVSQLAYGAWVSFGNQLDVXEAKSLLQCCRDHGVNFFDNAEVYANGRAEEIMGQAIRELGWKRSDIVVSTKIFWGGQGPNDKGLSRKHIVEGTKASLKRLDMDYVDVIYCHRPDTSTPIEETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGIAERLDLVGPI 587
            +LG+SGLRVS L  G WV+FG Q+    A+ L+    + GVN FD AEVYA G+AE I+G  I++ GW+RS +V++TK++WGG+   ++GLSRKHI+EG K SL+RL ++YVDV++ +RPD++TP+EE VRAM +VI++G A YWGTS WSA +I EA+ +A + +++ P+
Sbjct:   82 NLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPV 252          
The following BLAST results are available for this feature:
BLAST of DC900033 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
KCAB_ORYSJ7.369e-8685.38Probable voltage-gated potassium channel subunit b... [more]
KCAB2_XENLA1.499e-5454.97Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB2_BOVIN4.360e-5454.39Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB2_RAT5.695e-5454.39Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB2_MOUSE5.695e-5454.39Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB2_HUMAN9.714e-5454.39Voltage-gated potassium channel subunit beta-2 OS=... [more]
KCAB1_CHICK3.125e-5252.05Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_RAT4.081e-5252.05Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_RABIT4.081e-5252.05Voltage-gated potassium channel subunit beta-1 OS=... [more]
KCAB1_MUSPU4.081e-5252.05Voltage-gated potassium channel subunit beta-1 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900033 VSS Citrus sinensis cDNA clone VS27Q42 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900033 ID=DC900033|Name=DC900033|organism=Citrus sinensis|type=EST|length=587bp
GTACACTTCCCCAACAGGCCAAAAAAACAGACAACAAAAAGGTTAAAAAA
GGAAATTACAAAATGCAATACAAGCACCTGGGGAGATCGGGGCTGAGAGT
GAGCCAGCTCGCGTACGGAGCGTGGGTCAGCTTCGGGAACCAGCTGGACG
TGANNGAGGCGAAGTCGCTCTTGCAATGCTGCCGCGACCACGGCGTCAAC
TTCTTCGACAATGCCGAGGTCTACGCCAACGGCCGCGCGGAAGAGATCAT
GGGCCAGGCCATTCGCGAGCTCGGGTGGAAGCGATCCGACATCGTCGTTT
CCACCAAGATCTTTTGGGGCGGCCAGGGCCCCAACGATAAAGGCCTCTCC
AGAAAACACATTGTCGAGGGCACCAAAGCTTCCTTGAAACGCCTCGACAT
GGATTACGTCGACGTTATTTATTGTCACAGGCCGGACACGTCGACACCGA
TAGAGGAGACGGTGAGGGCGATGAATTATGTGATTGATAAGGGGTGGGCG
TTTTACTGGGGAACAAGTGAGTGGTCGGCGCAGCAGATCACCGAGGCTTG
GGGGATTGCTGAGCGCTTGGATTTGGTGGGCCCCATT
back to top