DC900024

Overview
NameDC900024
Unique NameDC900024
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length787
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900024 vs. ExPASy Swiss-Prot
Match: VPE_CITSI (Vacuolar-processing enzyme OS=Citrus sinensis PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 3.384e-38
Identity = 83/184 (45.11%), Postives = 116/184 (63.04%), Query Frame = 2
Query:  170 YLDLSSHVMQYGNKELSKEPIFTYIGTNPDXDNFTMKAEEFSSNPSAEIAHSSRLTRGAVSQRDAQLHYLWHRFNRSADGSSEKIEAQKQLQNEILSRQQVDQNIHQIIALVFGEENVSKMIESIRPAGQPLVDDWDCLKMLVIIYGEICGSLSVYGKKYTRAMANMCNAGINEKQMTLASNQA 721
            Y    SHVMQYG+  LSK  +FTY+GTNP  DN+T   +E S  P+++          AV+QRDA L + W ++ ++ +G+  K EAQKQ    +  R  VD +I  I  L+FG E   +++ ++RPAGQPLVDDW CLK LV  +   CG+LS YG K+ R++AN+CN GI +++M  AS QA
Sbjct:  304 YNSYGSHVMQYGDIGLSKNNLFTYLGTNPANDNYTF-VDENSLRPASK----------AVNQRDADLLHFWDKYRKAPEGTPRKAEAQKQFFEAMSHRMHVDHSIKLIGKLLFGIEKGPEILNTVRPAGQPLVDDWGCLKSLVRTFESHCGALSQYGMKHMRSLANICNTGIGKEKMAEASAQA 476          
BLAST of DC900024 vs. ExPASy Swiss-Prot
Match: VPE_VICSA (Vacuolar-processing enzyme OS=Vicia sativa PE=1 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 4.137e-36
Identity = 78/179 (43.58%), Postives = 113/179 (63.13%), Query Frame = 2
Query:  185 SHVMQYGNKELSKEPIFTYIGTNPDXDNFTMKAEEFSSNPSAEIAHSSRLTRGAVSQRDAQLHYLWHRFNRSADGSSEKIEAQKQLQNEILSRQQVDQNIHQIIALVFGEENVSKMIESIRPAGQPLVDDWDCLKMLVIIYGEICGSLSVYGKKYTRAMANMCNAGINEKQMTLASNQA 721
            SHVM+YG+  LSK  ++ Y+GTNP  DN +   E        E +   R    AV+QRDA L + W +F ++ +GSS+K EA+KQ+   +  R+ +D ++  I  L+FG E  +++++ +RPAG PLVD+WDCLK +V  +   CGSLS YG K+ R+ AN+CNAGI  + M  AS QA
Sbjct:  304 SHVMEYGDIGLSKNDLYQYLGTNPANDNNSFVDE-------TENSLKLRTPSAAVNQRDADLIHFWEKFRKAPEGSSQKNEAEKQVLEAMSHRKHIDNSVKLIGQLLFGIEKGTELLDVVRPAGSPLVDNWDCLKTMVKTFETHCGSLSQYGMKHMRSFANICNAGIPNEPMAEASAQA 475          
BLAST of DC900024 vs. ExPASy Swiss-Prot
Match: VPEA_ARATH (Vacuolar-processing enzyme alpha-isozyme OS=Arabidopsis thaliana GN=At2g25940 PE=2 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 7.056e-36
Identity = 82/179 (45.81%), Postives = 115/179 (64.25%), Query Frame = 2
Query:  185 SHVMQYGNKELSKEPIFTYIGTNPDXDNFTMKAEEFSSNPSAEIAHSSRLTRGAVSQRDAQLHYLWHRFNRSADGSSEKIEAQKQLQNEILSRQQVDQNIHQIIALVFGEENVSKMIESIRPAGQPLVDDWDCLKMLVIIYGEICGSLSVYGKKYTRAMANMCNAGINEKQMTLASNQA 721
            SHVM++G+  LSKE +  ++GTNP  +NFT   E     PS       R+T    +QRDA L + WH++ ++ +GS+ K+EAQKQ+   +  R  VD +I  I  L+FG E  + ++  +RP+G+PLVDDWDCLK LV  +   CGSLS YG K+ R++ANMCNAGI  +QM  A+ QA
Sbjct:  294 SHVMEFGDIGLSKEKLVLFMGTNPADENFTFVNENSIRPPS-------RVT----NQRDADLVHFWHKYQKAPEGSARKVEAQKQVLEAMSHRLHVDNSILLIGILLFGLEGHA-VLNKVRPSGEPLVDDWDCLKSLVRAFERHCGSLSQYGIKHMRSIANMCNAGIQMRQMEEAAMQA 460          
BLAST of DC900024 vs. ExPASy Swiss-Prot
Match: VPE1_PHAVU (Vacuolar-processing enzyme OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 2.053e-35
Identity = 78/179 (43.58%), Postives = 112/179 (62.57%), Query Frame = 2
Query:  185 SHVMQYGNKELSKEPIFTYIGTNPDXDNFTMKAEEFSSNPSAEIAHSSRLTRGAVSQRDAQLHYLWHRFNRSADGSSEKIEAQKQLQNEILSRQQVDQNIHQIIALVFGEENVSKMIESIRPAGQPLVDDWDCLKMLVIIYGEICGSLSVYGKKYTRAMANMCNAGINEKQMTLASNQA 721
            SHVMQYG+  LSK+ +F Y+GT+P  +N T   E         +  SS+    AV+QRDA L + W +F ++ +GS +K EA+KQ+   +  R  +D ++  +  L+FG E   +++ ++RPAG  LVDDWDCLK +V  +   CGSLS YG K+ R+ ANMCN GI ++QM  AS QA
Sbjct:  299 SHVMQYGDVGLSKDILFHYLGTDPANENLTFVDEN-------SLWSSSK----AVNQRDADLVHFWDKFRKAPEGSPKKNEARKQVLEVMSHRMHIDDSVELVGKLLFGIEKAPELLNAVRPAGSALVDDWDCLKTMVRTFETHCGSLSQYGMKHMRSFANMCNVGIKKEQMREASAQA 466          
BLAST of DC900024 vs. ExPASy Swiss-Prot
Match: VPEG_ARATH (Vacuolar-processing enzyme gamma-isozyme OS=Arabidopsis thaliana GN=At4g32940 PE=2 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 2.510e-33
Identity = 74/179 (41.34%), Postives = 110/179 (61.45%), Query Frame = 2
Query:  185 SHVMQYGNKELSKEPIFTYIGTNPDXDNFTMKAEEFSSNPSAEIAHSSRLTRGAVSQRDAQLHYLWHRFNRSADGSSEKIEAQKQLQNEILSRQQVDQNIHQIIALVFGEENVSKMIESIRPAGQPLVDDWDCLKMLVIIYGEICGSLSVYGKKYTRAMANMCNAGINEKQMTLASNQA 721
            SHVMQYG+  +SK+ +  Y+GTNP  DNFT  A+  S  P + + +          QRDA L + W ++ ++ +GS+ K EAQKQ+   +  R  +D ++  +  ++FG     +++  +R AGQPLVDDW+CLK  V  +   CGSLS YG K+ R+ AN+CNAGI  +QM  A++QA
Sbjct:  309 SHVMQYGDVGISKDNLDLYMGTNPANDNFTF-ADANSLKPPSRVTN----------QRDADLVHFWEKYRKAPEGSARKTEAQKQVLEAMSHRLHIDNSVILVGKILFGISRGPEVLNKVRSAGQPLVDDWNCLKNQVRAFERHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQA 476          
BLAST of DC900024 vs. ExPASy Swiss-Prot
Match: VPE_RICCO (Vacuolar-processing enzyme OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 6.834e-31
Identity = 68/179 (37.99%), Postives = 104/179 (58.10%), Query Frame = 2
Query:  185 SHVMQYGNKELSKEPIFTYIGTNPDXDNFTMKAEEFSSNPSAEIAHSSRLTRGAVSQRDAQLHYLWHRFNRSADGSSEKIEAQKQLQNEILSRQQVDQNIHQIIALVFGEENVSKMIESIRPAGQPLVDDWDCLKMLVIIYGEICGSLSVYGKKYTRAMANMCNAGINEKQMTLASNQA 721
            SHVMQYGN+ +  + ++ + G +P   NF         N   E+          V+QRDA+LH++W  + RS +GS +K E  +Q+++ I  R  +D ++  I  L+FG +  S +++S+R  G PLVDDW CLK +V ++   CGSL+ YG K+ R  AN+CNAG++   M  A N A
Sbjct:  313 SHVMQYGNQSIKADKLYLFQGFDPASVNFPPNNAHL--NAPMEV----------VNQRDAELHFMWQLYKRSENGSEKKKEILQQIKDAIKHRSHLDSSMQLIGDLLFGPKKASAILKSVREPGSPLVDDWGCLKSMVRVFETCCGSLTQYGMKHMRTFANICNAGVSHTSMEEACNAA 479          
BLAST of DC900024 vs. ExPASy Swiss-Prot
Match: VPEB_ARATH (Vacuolar-processing enzyme beta-isozyme OS=Arabidopsis thaliana GN=At1g62710 PE=2 SV=3)

HSP 1 Score: 128.642 bits (322), Expect = 3.750e-29
Identity = 68/179 (37.99%), Postives = 102/179 (56.98%), Query Frame = 2
Query:  185 SHVMQYGNKELSKEPIFTYIGTNPDXDNFTMKAEEFSSNPSAEIAHSSRLTRGAVSQRDAQLHYLWHRFNRSADGSSEKIEAQKQLQNEILSRQQVDQNIHQIIALVFGEENVSKMIESIRPAGQPLVDDWDCLKMLVIIYGEICGSLSVYGKKYTRAMANMCNAGINEKQMTLASNQA 721
            SHVM+YGN  +  E ++ Y G +P   N           P  E+   S++  G V+QRDA L +LWH +  S DGS +K +  K+L      R+ +D ++  I  ++FG      ++  +R  G PLVDDW+CLK +V ++ E CGSL+ YG K+ RA AN+CN G++++ M  AS  A
Sbjct:  302 SHVMEYGNNSIKSEKLYLYQGFDPATVNL----------PLNELPVKSKI--GVVNQRDADLLFLWHMYRTSEDGSRKKDDTLKELTETTRHRKHLDASVELIATILFGP--TMNVLNLVREPGLPLVDDWECLKSMVRVFEEHCGSLTQYGMKHMRAFANVCNNGVSKELMEEASTAA 466          
BLAST of DC900024 vs. ExPASy Swiss-Prot
Match: VPE2_PHAVU (Vacuolar-processing enzyme OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.425e-28
Identity = 66/179 (36.87%), Postives = 101/179 (56.42%), Query Frame = 2
Query:  179 LSSHVMQYGNKELSKEPIFTYIGTNPDXDNFTMKAEEFSSNPSAEIAHSSRLTRG--AVSQRDAQLHYLWHRFNRSADGSSEKIEAQKQLQNEILSRQQVDQNIHQIIALVFGEENVSKMIESIRPAGQPLVDDWDCLKMLVIIYGEICGSLSVYGKKYTRAMANMCNAGINEKQMTLA 709
            + SHVMQYG+  ++ E ++ Y G +P   NF                H+ RL      V+QRDA+L ++W  + RS     +K +  KQ++  +  R+ +D ++  I  L++G E  S ++ S+R  G PLVDDW CLK +V +Y   CGSL+ YG K+ RA AN+CN+G++E  M  A
Sbjct:  307 MGSHVMQYGDANMTAEKLYLYHGFDPATVNFP--------------PHNGRLKSKMEVVNQRDAELLFMWQVYQRSNHLPEKKTDILKQIEEIVKHRKHLDGSVELIGVLLYGPEKASSVLRSVRTTGLPLVDDWTCLKSMVRVYETHCGSLTQYGMKHMRAFANICNSGVSETSMEKA 471          
BLAST of DC900024 vs. ExPASy Swiss-Prot
Match: VPE_SOYBN (Vacuolar-processing enzyme OS=Glycine max PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.742e-26
Identity = 60/174 (34.48%), Postives = 95/174 (54.60%), Query Frame = 2
Query:  179 LSSHVMQYGNKELSKEPIFTYIGTNPDXDNFTMKAEEFSSNPSAEIAHSSRLTRGAVSQRDAQLHYLWHRFNRSADGSSEKIEAQKQLQNEILSRQQVDQNIHQIIALVFGEENVSKMIESIRPAGQPLVDDWDCLKMLVIIYGEICGSLSVYGKKYTRAMANMCNAGINEKQM 700
            + SHVMQYG+  ++ E ++ Y G +P   NF  +     +                V+QRDA+L  LW  + RS   S  K +  KQ+   +  R+ +D ++  I  L++G    S +++S+R  G  LVDDW CLK +V ++   CG+L+ YG K+ RA AN+CN+G++E  M
Sbjct:  309 MGSHVMQYGDTNITAEKLYLYQGFDPATVNFPPQNGRLETKMEV------------VNQRDAELFLLWQMYQRSNHQSENKTDILKQIAETVKHRKHIDGSVELIGVLLYGPGKGSSVLQSVRAPGSSLVDDWTCLKSMVRVFETHCGTLTQYGMKHMRAFANICNSGVSEASM 470          
BLAST of DC900024 vs. ExPASy Swiss-Prot
Match: LEGU_CANEN (Legumain OS=Canavalia ensiformis PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 3.285e-25
Identity = 61/179 (34.08%), Postives = 97/179 (54.19%), Query Frame = 2
Query:  185 SHVMQYGNKELSKEPIFTYIGTNPDXDNFTMKAEEFSSNPSAEIAHSSRLTRGAVSQRDAQLHYLWHRFNRSADGSSEKIEAQKQLQNEILSRQQVDQNIHQIIALVFGEENVSKMIESIRPAGQPLVDDWDCLKMLVIIYGEICGSLSVYGKKYTRAMANMCNAGINEKQMTLASNQA 721
            SHVMQYG+  ++ E ++ Y G +P   NF       + N  A++          V+QRDA+L ++W  + RS     +K    +Q+   +  R  +D ++  I  L++G    S ++ S+R  G PLVDDW CLK +V ++   CGSL+ YG K+ RA  N+CN+G+++  M  A   A
Sbjct:  291 SHVMQYGDTNITAEKLYLYHGFDPATVNFP----PHNGNLEAKME--------VVNQRDAELLFMWQMYQRSNHQPEKKTHILEQITETVKHRNHLDGSVELIGVLLYGPGKSSSVLHSVRAPGLPLVDDWTCLKSMVRVFETHCGSLTQYGMKHMRAFGNVCNSGVSKASMEEACKAA 457          
The following BLAST results are available for this feature:
BLAST of DC900024 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
VPE_CITSI3.384e-3845.11Vacuolar-processing enzyme OS=Citrus sinensis PE=2... [more]
VPE_VICSA4.137e-3643.58Vacuolar-processing enzyme OS=Vicia sativa PE=1 SV... [more]
VPEA_ARATH7.056e-3645.81Vacuolar-processing enzyme alpha-isozyme OS=Arabid... [more]
VPE1_PHAVU2.053e-3543.58Vacuolar-processing enzyme OS=Phaseolus vulgaris P... [more]
VPEG_ARATH2.510e-3341.34Vacuolar-processing enzyme gamma-isozyme OS=Arabid... [more]
VPE_RICCO6.834e-3137.99Vacuolar-processing enzyme OS=Ricinus communis PE=... [more]
VPEB_ARATH3.750e-2937.99Vacuolar-processing enzyme beta-isozyme OS=Arabido... [more]
VPE2_PHAVU1.425e-2836.87Vacuolar-processing enzyme OS=Phaseolus vulgaris P... [more]
VPE_SOYBN1.742e-2634.48Vacuolar-processing enzyme OS=Glycine max PE=2 SV=... [more]
LEGU_CANEN3.285e-2534.08Legumain OS=Canavalia ensiformis PE=1 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionDC900024 VSS Citrus sinensis cDNA clone VS27Q32 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900024 ID=DC900024|Name=DC900024|organism=Citrus sinensis|type=EST|length=787bp
CCGGCTCACCCCCCAAANCATTCCAAGTATGCCCGGCATATCCAGTCCAG
GATGATTTGAACCTGTTGGGNATCTCTCCGTTTTCTGGATGAGANAGTGA
AAAACCATTTTTNCAGAAGGAACCCCTCCACCACCACATGGAGGGGTTCG
GAGGAGGCCATTGGTAGATTATTTAGACCTTAGCTCTCATGTAATGCAGT
ACGGAAACAAAGAGCTGAGCAAAGAGCCAATTTTTACGTATATTGGCACG
AATCCTGATANCGACAACTTCACGATGAAGGCTGAAGAATTTTCTTCTAA
CCCATCAGCTGAAATTGCTCATTCGAGTCGTTTGACGAGGGGAGCTGTTA
GTCAACGCGATGCTCAACTTCATTATCTTTGGCACAGGTTCAATAGATCG
GCTGATGGGTCTAGTGAGAAGATCGAAGCTCAGAAGCAATTACAGAATGA
GATTTTAAGCAGGCAGCAAGTGGATCAAAATATTCATCAAATCATAGCAC
TAGTTTTTGGGGAAGAAAATGTGTCGAAAATGATTGAGTCCATTCGACCA
GCAGGCCAGCCTCTTGTAGACGACTGGGATTGCTTGAAAATGCTTGTGAT
AATTTATGGGGAAATTTGTGGATCATTATCAGTATATGGAAAGAAGTACA
CAAGAGCAATGGCCAACATGTGCAATGCTGGAATCAATGAGAAGCAGATG
ACTTTGGCATCCAATCAAGCTTGTTTGAAATAAAATAAGTAAAATAATTG
TTTGAATAAGNTACTTGAAATAAAATACGTCTTTGAA
back to top