DC900010

Overview
NameDC900010
Unique NameDC900010
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length589
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8868 contig Csv1_Contig8868:185..773. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900010 vs. ExPASy Swiss-Prot
Match: CBWD1_RAT (COBW domain-containing protein 1 OS=Rattus norvegicus GN=Cbwd1 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.178e-12
Identity = 45/149 (30.20%), Postives = 81/149 (54.36%), Query Frame = 2
Query:    8 RCQVDLFEVLNCRAYDATHVTRLEGLLEEHQYKSSQNLHDNNVRTLSICEPLAVNLDKVRLWLEEILWDK----KDG--MDVYRCKGVLSVKHSDQLHTLQAVREIYEIVPAR-KWRTEENQMNKIVFIGHHLNQDILQDSFRTCTLAT 433
            R +  L  +L+  AYD      L+  L   Q+ S+    D ++ T++   P +   + + ++++ +LW+K    KDG  M+V R KG++S+K   Q   +Q + E+YE+  +R  W+ +  +  ++VFIG +L++DILQ  F T    T
Sbjct:  233 RSRTHLSNILDLHAYDTLSGISLQKKL---QHVSTAPHLDQSIVTVTFDVPGSAEEESLNVFIQNLLWEKNVKNKDGRCMEVIRLKGLVSIKDKPQQMIVQGIHELYELEESRVNWKDDAERACQLVFIGKNLDKDILQQLFITAVAET 378          
The following BLAST results are available for this feature:
BLAST of DC900010 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
CBWD1_RAT4.178e-1230.20COBW domain-containing protein 1 OS=Rattus norvegi... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900010 VSS Citrus sinensis cDNA clone VS27Q21 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900010 ID=DC900010|Name=DC900010|organism=Citrus sinensis|type=EST|length=589bp
CTCTGTTCGATGTCAAGTTGACCTGTTTGAAGTATTGAATTGTCGAGCAT
ATGATGCCACACATGTCACTCGTCTAGAAGGACTGTTGGAGGAACACCAA
TATAAATCTTCTCAGAATCTTCATGACAATAATGTGCGAACCTTGTCCAT
TTGTGAACCACTGGCAGTTAATCTTGATAAGGTTCGCTTATGGCTTGAGG
AGATTCTTTGGGATAAAAAAGATGGTATGGATGTGTACCGTTGCAAAGGG
GTTTTAAGTGTTAAACACTCCGATCAACTGCATACTTTGCAGGCTGTGAG
GGAGATTTATGAGATTGTTCCAGCTCGAAAATGGAGAACAGAGGAGAATC
AGATGAATAAGATAGTTTTTATAGGTCATCACCTGAATCAAGACATTCTT
CAAGATTCCTTCAGAACTTGCACATTAGCAACTACTTAGCTTATAGTGAG
AAGCATTTTGAAGAGATTTGCCATCTTGAAGCTTCAATTTTCTAAAGATT
GTTTTTTGAGTCCAATTATTTTGAATGGAGCTCAAGCAGTTAGTTCATAC
AGTGTATACCGATTTTACCTGTTGAGTAGACTTTTTCTC
back to top