DC900005

Overview
NameDC900005
Unique NameDC900005
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length518
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9396 contig Csv1_Contig9396:268..783. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900005 vs. ExPASy Swiss-Prot
Match: CML35_ARATH (Probable calcium-binding protein CML35 OS=Arabidopsis thaliana GN=CML35 PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 1.497e-14
Identity = 57/133 (42.86%), Postives = 68/133 (51.13%), Query Frame = 3
Query:   72 IEKLSPKRLFRSKSKKXXXXXXXXXXXXXXXXXXXXXXXHNKLGSAPDRVGTPTSVLHEISGDWSDMSADISLDLNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVSSMLSEVDREGDGYIPL 470
            + +LSPKRLFR+KSK                         N L   P    TP SVL + SGD+             ELVQA KL+DRD+DGVV R +L AL+ RL  +PP+QEEVS ML EVD    G I L
Sbjct:    7 LNRLSPKRLFRTKSKASVSRSEPSSFSSNASSSSSDGSYGN-LKQGP--TATPISVLPQNSGDFYT-----------ELVQAFKLIDRDDDGVVSRGDLAALISRLSHEPPSQEEVSLMLREVDGGDGGCISL 125          
BLAST of DC900005 vs. ExPASy Swiss-Prot
Match: CML36_ARATH (Probable calcium-binding protein CML36 OS=Arabidopsis thaliana GN=CML36 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.336e-14
Identity = 50/133 (37.59%), Postives = 65/133 (48.87%), Query Frame = 3
Query:   72 IEKLSPKRLFRSKSKKXXXXXXXXXXXXXXXXXXXXXXXHNKLGSAPDRVGTPTSVLHEISGDWSDMSADISLDLNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVSSMLSEVDREGDGYIPL 470
            + KL PKR F     +                        N  G       TPTS+L E+   +S +          E++QA KL+DRDNDG V R +LE+LL RLG DP T+EE++ ML EVD +GDG I L
Sbjct:    3 LAKLIPKRFFIRSKDRSTVSKSPTAFSFGSASSSSGQDCKNSGGDGGGGSVTPTSILPEVPSPYSYV----------EILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEEEINVMLKEVDCDGDGTIRL 125          
The following BLAST results are available for this feature:
BLAST of DC900005 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
CML35_ARATH1.497e-1442.86Probable calcium-binding protein CML35 OS=Arabidop... [more]
CML36_ARATH3.336e-1437.59Probable calcium-binding protein CML36 OS=Arabidop... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900005 VSS Citrus sinensis cDNA clone VS27Q17 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900005 ID=DC900005|Name=DC900005|organism=Citrus sinensis|type=EST|length=518bp
GTTTCCTCTTTTTCCCTTCACGAGAAACTCGAATTCGTCTTTTTTTTCTT
CGCGTTTCGGAAATGAAACTCATCGAGAAGCTCAGCCCGAAACGTCTCTT
CCGGTCCAAGTCCAAGAAGGACCGGACCAGCGTTTCGCGTTCTGACCCAT
CATCGTTNAGCTCGTCCTCTACCTCCGACTCGTCCACCCACAACAAACTC
GGTTCGGCGCCGGACAGAGTCGGGACGCCCACGAGTGTCTTACACGAGAT
ATCGGGTGACTGGTCCGACATGTCGGCCGATATCTCGCTAGATTTGAACT
ACGAGCTCGTCCAGGCTTGTAAGTTGCTCGACAGGGACAACGACGGGGTG
GTGTTGAGAAGCGAGCTGGAGGCGCTCTTGATCCGGCTCGGAGCGGACCC
GCCGACCCAAGAGGAGGTCTCGTCGATGCTGAGCGAGGTGGATCGGGAGG
GCGATGGGTATATACCCCTTGGAGGCGCTGATAAGCCGGGTCNGGGAACT
CGTCTTGCGAGCCGGCTT
back to top