DC900003

Overview
NameDC900003
Unique NameDC900003
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length545
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5630 contig Csv1_Contig5630:1..545. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y4372_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g37250 OS=Arabidopsis thaliana GN=At4g37250 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.261e-27
Identity = 64/144 (44.44%), Postives = 86/144 (59.72%), Query Frame = 2
Query:  167 CFRKDESETLSENVEQYD-----------------LVPLDTQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGG--SQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            C RKD   T SE  ++ D                 LV +D +   +++ LLKASA++LG +G  I+YK VLEDG   AVRRLGE G   +RFK+F+  + AIGK+ HPN+V L  +YW  DE L+IYD++PNGSL    + K G
Sbjct:  398 CLRKDPETTPSEEEDEDDEDEESGYNANQRSGDNKLVTVDGEKEMEIETLLKASAYILGATGSSIMYKAVLEDGRVFAVRRLGENGLSQRRFKDFEPHIRAIGKLVHPNLVRLCGFYWGTDEKLVIYDFVPNGSLVNPRYRKGG 541          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y2267_ARATH (Probable inactive receptor kinase At2g26730 OS=Arabidopsis thaliana GN=At2g26730 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.620e-25
Identity = 53/99 (53.54%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  245 AFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            +FDL++LL+ASA VLGK  +G  YK VLE+G T+ V+RL +  + + KEF+T++E +GKI+HPN++ LRAYY+S DE LL++D++P GSL+  LHG  G
Sbjct:  343 SFDLEDLLRASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVMASK-KEFETQMEVVGKIKHPNVIPLRAYYYSKDEKLLVFDFMPTGSLSALLHGSRG 440          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: RPKL_ARATH (Receptor protein kinase-like protein At4g34220 OS=Arabidopsis thaliana GN=At4g34220 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 6.807e-24
Identity = 56/103 (54.37%), Postives = 71/103 (68.93%), Query Frame = 2
Query:  212 QYDLVPLDTQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGG--SQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            Q  LV +D +   DLD LLKASA++LG +G GIVYK VLE+G   AVRR+      + + KEF+ EV AI K+RHPN+V +R + W  DE LLI DY+PNGSL
Sbjct:  452 QTQLVTVDGETRLDLDTLLKASAYILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSL 554          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5332_ARATH (Probable inactive receptor kinase At5g53320 OS=Arabidopsis thaliana GN=At5g53320 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.419e-21
Identity = 49/101 (48.51%), Postives = 71/101 (70.30%), Query Frame = 2
Query:  242 VAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPGM 544
            + FDL++LL+ASA VLGK   G  YKV LED  T+ V+R+ E    + +EF+ ++E IG I+H N+ TLR Y++S DE L++YDY  +GSL+  LHG+ G+
Sbjct:  299 LVFDLEDLLRASAEVLGKGPFGTTYKVDLEDSATIVVKRIKEVSVPQ-REFEQQIENIGSIKHENVATLRGYFYSKDEKLVVYDYYEHGSLSTLLHGQKGL 398          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y4374_ARATH (Probable inactive receptor kinase At4g23740 OS=Arabidopsis thaliana GN=At4g23740 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.421e-21
Identity = 49/99 (49.49%), Postives = 71/99 (71.72%), Query Frame = 2
Query:  245 AFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            +FDL++LL+ASA VLGK   G  YK VLED  ++AV+RL +  + + ++F+ ++E IG I+H N+V L+AYY+S DE L++YDY   GS+A  LHG  G
Sbjct:  329 SFDLEDLLRASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGK-RDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHGNRG 426          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: IMK3_ARATH (Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 7.045e-21
Identity = 61/161 (37.89%), Postives = 89/161 (55.28%), Query Frame = 2
Query:   59 LVGLLFSYCYSRVCGFGEGKDENCYAKGGKGRXECLCFRKDESETLSENVEQYD-LVPLDTQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWS-VDENLLIYDYIPNGSLAXALHGK 535
            L+ +L   C   +C     K     AKGG+     +  + ++        E    LV  D  +AF  D+LL A+A ++GKS  G VYK  LEDG  +AV+RL E  ++  KEF+ E+  +G+IRHPN++ LRAYY     E L+++DY+  GSLA  LH +
Sbjct:  419 LIVMLILVCV--LCCLLRKKANETKAKGGEAGPGAVAAKTEKGGEAEAGGETGGKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKATLEDGSQVAVKRLREKITKSQKEFENEINVLGRIRHPNLLALRAYYLGPKGEKLVVFDYMSRGSLATFLHAR 577          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y3868_ARATH (Probable inactive receptor kinase At3g08680 OS=Arabidopsis thaliana GN=At3g08680 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.677e-20
Identity = 57/142 (40.14%), Postives = 86/142 (60.56%), Query Frame = 2
Query:  113 GKDENCYAKGGKGRXECLCFRKDESETLSENVEQYDLVPLD-TQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIR-HPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            G+D     K   GR +    + +E  +  +  E+  LV  + +   FDL++LL+ASA VLGK   G  YK +LE+G T+ V+RL E  + + +EF+ ++EA+G+I  H N+  LRAYY+S DE LL+YDY   G+ +  LHG
Sbjct:  291 GQDSTAVPKAKPGRSDN---KAEEFGSGVQEAEKNKLVFFEGSSYNFDLEDLLRASAEVLGKGSYGTTYKAILEEGTTVVVKRLKEVAAGK-REFEQQMEAVGRISPHVNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHG 428          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5830_ARATH (Probable inactive receptor kinase At5g58300 OS=Arabidopsis thaliana GN=At5g58300 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.735e-19
Identity = 48/99 (48.48%), Postives = 69/99 (69.70%), Query Frame = 2
Query:  248 FDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKI-RHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            FDL++LL+ASA VLGK   G  YK VLE+  T+ V+RL E  + + +EF+ ++E I ++  HP++V LRAYY+S DE L++ DY P G+L+  LHG  G
Sbjct:  351 FDLEDLLRASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVAAGK-REFEQQMEIISRVGNHPSVVPLRAYYYSKDEKLMVCDYYPAGNLSSLLHGNRG 448          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: RLK90_ARATH (Probable inactive receptor kinase RLK902 OS=Arabidopsis thaliana GN=RLK902 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.266e-19
Identity = 48/98 (48.98%), Postives = 68/98 (69.39%), Query Frame = 2
Query:  248 FDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            FDL++LL+ASA VLGK   G  YK VL+    +AV+RL +  +   +EF+ ++E +G + H N+V LRAYY+S DE LL+YD++P GSL+  LHG  G
Sbjct:  358 FDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDV-TMADREFKEKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKG 454          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5516_ARATH (Probable receptor kinase At5g05160 OS=Arabidopsis thaliana GN=At5g05160 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.960e-19
Identity = 51/99 (51.52%), Postives = 66/99 (66.67%), Query Frame = 2
Query:  248 FDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKI-RHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            FDL++LLKASA VLGK   G  YK VLED   + V+RL E  + + KEF+ ++E +GKI +H N V L AYY+S DE LL+Y Y+  GSL   +HG  G
Sbjct:  340 FDLEDLLKASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASK-KEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHGNRG 437          
The following BLAST results are available for this feature:
BLAST of DC900003 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
Y4372_ARATH2.261e-2744.44Probable LRR receptor-like serine/threonine-protei... [more]
Y2267_ARATH1.620e-2553.54Probable inactive receptor kinase At2g26730 OS=Ara... [more]
RPKL_ARATH6.807e-2454.37Receptor protein kinase-like protein At4g34220 OS=... [more]
Y5332_ARATH1.419e-2148.51Probable inactive receptor kinase At5g53320 OS=Ara... [more]
Y4374_ARATH2.421e-2149.49Probable inactive receptor kinase At4g23740 OS=Ara... [more]
IMK3_ARATH7.045e-2137.89Probable leucine-rich repeat receptor-like protein... [more]
Y3868_ARATH2.677e-2040.14Probable inactive receptor kinase At3g08680 OS=Ara... [more]
Y5830_ARATH1.735e-1948.48Probable inactive receptor kinase At5g58300 OS=Ara... [more]
RLK90_ARATH2.266e-1948.98Probable inactive receptor kinase RLK902 OS=Arabid... [more]
Y5516_ARATH2.960e-1951.52Probable receptor kinase At5g05160 OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900003 VSS Citrus sinensis cDNA clone VS27Q14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900003 ID=DC900003|Name=DC900003|organism=Citrus sinensis|type=EST|length=545bp
AGGGCTTAGTAAGAGTGCTATAGTAGCTATAATTGTGAGTGATGTAATTG
GAATTTGCCTTGTCGGGCTATTGTTCTCATATTGTTATTCAAGGGTTTGT
GGTTTTGGCGAGGGCAAGGATGAAAATTGTTATGCAAAAGGAGGTAAGGG
AAGANAAGAGTGCTTGTGCTTCAGGAAAGATGAATCAGAGACTCTCTCAG
AGAATGTTGAACAGTATGACCTTGTGCCGCTGGATACACAGGTGGCTTTT
GATTTGGATGAGCTGCTTAAGGCTTCAGCTTTTGTTCTTGGCAAGAGTGG
AATTGGGATTGTATACAAAGTTGTGCTTGAAGATGGACTTACTTTAGCCG
TGAGAAGGTTGGGTGAAGGCGGCTCTCAGAGGTTTAAGGAGTTCCAAACC
GAAGTAGAAGCAATTGGGAAGATAAGGCATCCAAACATTGTAACTCTCAG
AGCATATTACTGGTCTGTTGATGAGAACCTGCTCATATATGATTATATAC
CTAATGGAAGCCTAGCCNCTGCACTCCATGGGAAGCCAGGAATGG
back to top