DC899998

Overview
NameDC899998
Unique NameDC899998
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length870
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2224 contig Csv1_Contig2224:197..1066. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH23_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 23 OS=Arabidopsis thaliana GN=XTH23 PE=2 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 2.200e-113
Identity = 189/243 (77.78%), Postives = 209/243 (86.01%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACV----WXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            I NNG LL+LSLDKASGSGFQSK+EYLFGKIDMQ+KLV GNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFT GKGDREQQF LWFDPT+DFHTYS+LWNPQRI+F VDG+PIREFKN+ES G LFPKNQPMR+YSSLWNA++WATRGGL+KTDW++APFTASYR FN  ACV                   W SQELD+ GQE+++WVQ NYMIYNYC D+KRFPQGLP+EC
Sbjct:   41 ITNNGDLLTLSLDKASGSGFQSKNEYLFGKIDMQIKLVAGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTQGKGDREQQFKLWFDPTSDFHTYSILWNPQRIIFSVDGTPIREFKNMESQGTLFPKNQPMRMYSSLWNAEEWATRGGLVKTDWSKAPFTASYRGFNEEACVVINGQSSCPNVSGQGSTGSWLSQELDSTGQEQMRWVQNNYMIYNYCTDAKRFPQGLPREC 283          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH22_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 22 OS=Arabidopsis thaliana GN=XTH22 PE=1 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.625e-110
Identity = 180/244 (73.77%), Postives = 207/244 (84.84%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVW-----XXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            I NNG+LL+LSLDK+SGSGFQSK+EYLFGK+ MQ+KLVPGNSAGTVT  YLKSPG+TWDEIDFEFLGN SG+PYTLHTNV+T GKGD+EQQF LWFDPTA+FHTY++LWNPQRI+F VDG+PIREFKN+ES G LFPKN+PMR+YSSLWNADDWATRGGL+KTDW++APFTASYR F   ACVW                   W SQELD+  Q+R++WVQ+NYMIYNYC D+KRFPQGLPKEC
Sbjct:   38 IKNNGELLTLSLDKSSGSGFQSKNEYLFGKVSMQMKLVPGNSAGTVTTLYLKSPGTTWDEIDFEFLGNSSGEPYTLHTNVYTQGKGDKEQQFKLWFDPTANFHTYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMRMYSSLWNADDWATRGGLVKTDWSKAPFTASYRGFQQEACVWSNGKSSCPNASKQGTTTGSWLSQELDSTAQQRMRWVQRNYMIYNYCTDAKRFPQGLPKEC 281          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH24_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 24 OS=Arabidopsis thaliana GN=XTH24 PE=1 SV=2)

HSP 1 Score: 390.193 bits (1001), Expect = 8.098e-108
Identity = 179/239 (74.90%), Postives = 204/239 (85.36%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            ILNNGQLL+LSLDK+SGSGFQSK+EYLFGKIDMQ+KLVPGNSAGTVT +YLKS GSTWDEIDFEFLGN+SGDPYTLHTNV+T GKGD+EQQFHLWFDPTA+FHTYS+LWNPQRI+  VD +PIREFKN ES GVLFPKN+PMR+Y+SLWNADDWATRGGL+KTDW++APF ASYRN   ++                 W++QE+D+  Q RLKWVQKNYMIYNYC D +RFPQG PKEC
Sbjct:   39 ILNNGQLLTLSLDKSSGSGFQSKTEYLFGKIDMQIKLVPGNSAGTVTTFYLKSEGSTWDEIDFEFLGNMSGDPYTLHTNVYTQGKGDKEQQFHLWFDPTANFHTYSILWNPQRIILTVDDTPIREFKNYESLGVLFPKNKPMRMYASLWNADDWATRGGLVKTDWSKAPFMASYRNIKIDS------------KPNSNWYTQEMDSTSQARLKWVQKNYMIYNYCTDHRRFPQGAPKEC 265          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH25_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 25 OS=Arabidopsis thaliana GN=XTH25 PE=2 SV=2)

HSP 1 Score: 386.341 bits (991), Expect = 1.169e-106
Identity = 177/239 (74.06%), Postives = 201/239 (84.10%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            +LNNG+LL+LSLD+ASGSGFQ+K EYLFGKIDMQLKLVPGNSAGTVTAYYLKS G TWDEIDFEFLGNL+GDPYT+HTNV+T GKGDREQQFHLWFDPTADFHTYSVLWNP  IVF VD  P+REFKNL+  G+ +PK QPMR+YSSLWNAD WATRGGL+KTDW++APFTASYRNF A+ACV               WFSQ LD   +++++ VQ+ YMIYNYC D+KRFPQG PKEC
Sbjct:   45 VLNNGELLTLSLDRASGSGFQTKKEYLFGKIDMQLKLVPGNSAGTVTAYYLKSKGDTWDEIDFEFLGNLTGDPYTMHTNVYTQGKGDREQQFHLWFDPTADFHTYSVLWNPHHIVFMVDDIPVREFKNLQHMGIQYPKLQPMRLYSSLWNADQWATRGGLVKTDWSKAPFTASYRNFRADACV-SSGGRSSCPAGSPRWFSQRLDLTAEDKMRVVQRKYMIYNYCTDTKRFPQGFPKEC 282          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH20_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 20 OS=Arabidopsis thaliana GN=XTH20 PE=2 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 2.136e-100
Identity = 162/238 (68.07%), Postives = 193/238 (81.09%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECA 721
            N G LLSLSLDK SGSGFQS  E+L+GK+++Q+KLVPGNSAGTVT +YLKSPG+TWDEIDFEFLGN+SG PYTLHTNV+T G GD+EQQFHLWFDPT DFHTY ++WNPQR++F +DG PIREFKN E+ GV FPK+QPMR+Y+SLW A+ WATRGGL KTDW++APFTA YRN+N +ACVW              WF+Q LD  G+ R+KW Q+ YM+YNYC D KRFPQG P EC+
Sbjct:   47 NVGNLLSLSLDKFSGSGFQSHQEFLYGKVEVQMKLVPGNSAGTVTTFYLKSPGTTWDEIDFEFLGNISGHPYTLHTNVYTKGTGDKEQQFHLWFDPTVDFHTYCIIWNPQRVIFTIDGIPIREFKNSEALGVPFPKHQPMRLYASLWEAEHWATRGGLEKTDWSKAPFTAFYRNYNVDACVW--SNGKSSCSANSSWFTQVLDFKGKNRVKWAQRKYMVYNYCTDKKRFPQGAPPECS 282          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH21_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 21 OS=Arabidopsis thaliana GN=XTH21 PE=2 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 4.759e-100
Identity = 168/254 (66.14%), Postives = 198/254 (77.95%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNA-NACVWXXXXXXXXXXXXXP-------------WFSQE-LDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            ILNNG LL+L LD++SGSGFQSK+EYL+GK+DMQ+KLVPGNSAGTVT +YLKS G TWDEIDFEFLGN+SGDPY +HTNV+T GKGDREQQF+LWFDPTA FH YS+LWNP  IVFY+DG PIREFKNLE  GV +PKNQPMR+Y SLWNADDWATRGGL+KT+W+Q PF AS+ N+N+ NACVW             P             WFSQ  +D+  ++ L+WVQ+ +M+YNYCKD KRF  GLP EC
Sbjct:   43 ILNNGTLLNLGLDQSSGSGFQSKAEYLYGKVDMQIKLVPGNSAGTVTTFYLKSQGLTWDEIDFEFLGNVSGDPYIVHTNVYTQGKGDREQQFYLWFDPTAAFHNYSILWNPSHIVFYIDGKPIREFKNLEVLGVAYPKNQPMRMYGSLWNADDWATRGGLVKTNWSQGPFVASFMNYNSENACVWSIVNGTTTTSPCSPGDSTSSSSSSTSEWFSQRGMDSSSKKVLRWVQRKFMVYNYCKDKKRFSNGLPVEC 296          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH19_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 19 OS=Arabidopsis thaliana GN=XTH19 PE=2 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 3.085e-99
Identity = 162/238 (68.07%), Postives = 191/238 (80.25%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECA 721
            N G+LLSLSLDK+SGSGFQS  E+L+GK ++Q+KLVPGNSAGTVT +YLKSPG+TWDEIDFEFLGN+SG PYTLHTNV+T G GD+EQQFHLWFDPTA+FHTY + WNPQRI+F VDG PIREF N ES GV FP  QPMR+Y+SLW A+ WATRGGL KTDW++APFTA YRN+N   CVW              WF+Q+LD+ GQ R+K VQ  YM+YNYC D KRFP+G+P EC+
Sbjct:   42 NQGKLLSLSLDKSSGSGFQSNQEFLYGKAEVQMKLVPGNSAGTVTTFYLKSPGTTWDEIDFEFLGNISGHPYTLHTNVYTKGSGDKEQQFHLWFDPTANFHTYCITWNPQRIIFTVDGIPIREFMNAESRGVPFPTKQPMRLYASLWEAEHWATRGGLEKTDWSKAPFTAYYRNYNVEGCVW--VNGKSVCPANSQWFTQKLDSNGQTRMKGVQSKYMVYNYCSDKKRFPRGVPPECS 277          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH17_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 17 OS=Arabidopsis thaliana GN=XTH17 PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.999e-98
Identity = 161/236 (68.22%), Postives = 192/236 (81.36%), Query Frame = 2
Query:   11 NGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            +G+LLSLSLDK+SGSGFQS  E+L+GK ++Q+KLVPGNSAGTVT +YLKSPG+TWDEIDFEFLGN+SG PYTLHTNV+T G GD+EQQFHLWFDPT +FHTY + WNPQRI+F VDG PIREFKN E+ GV FP  QPMR+Y+SLW A+ WATRGGL KTDW++APFTA YRN+N + CVW             PWF+Q+LD+ GQ R+K VQ  YMIYNYC D +RFP+G+P EC
Sbjct:   48 DGKLLSLSLDKSSGSGFQSNQEFLYGKAEVQMKLVPGNSAGTVTTFYLKSPGTTWDEIDFEFLGNISGHPYTLHTNVYTKGTGDKEQQFHLWFDPTVNFHTYCITWNPQRIIFTVDGIPIREFKNPEAIGVPFPTRQPMRLYASLWEAEHWATRGGLEKTDWSKAPFTAFYRNYNVDGCVW--ANGKSSCSANSPWFTQKLDSNGQTRMKGVQSKYMIYNYCTDKRRFPRGVPAEC 281          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XTH18_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 18 OS=Arabidopsis thaliana GN=XTH18 PE=2 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 2.611e-98
Identity = 161/237 (67.93%), Postives = 191/237 (80.59%), Query Frame = 2
Query:   11 NGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKECA 721
            +G+LLSLSLDK+SGSGFQS  E+L+GK ++Q+KLVPGNSAGTVT +YLKSPG+TWDEIDFEFLGNLSG PYTLHTNV+T G GD+EQQFHLWFDPT +FHTY + WNPQRI+F VDG PIREFKN ES GV FP  QPMR+Y+SLW A+ WATRGGL KTDW++APFTA YRN+N   CVW              WF+Q+LD+ GQ R+K VQ  YM+YNYC D +RFP+G+P EC+
Sbjct:   48 DGKLLSLSLDKSSGSGFQSNQEFLYGKAEVQMKLVPGNSAGTVTTFYLKSPGTTWDEIDFEFLGNLSGHPYTLHTNVYTKGSGDKEQQFHLWFDPTVNFHTYCITWNPQRIIFTVDGIPIREFKNSESIGVPFPTKQPMRLYASLWEAEHWATRGGLEKTDWSKAPFTAFYRNYNVEGCVW--ANGKSSCPANSSWFTQQLDSNGQTRMKGVQSKYMVYNYCNDKRRFPRGVPVECS 282          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: BRU1_SOYBN (Brassinosteroid-regulated protein BRU1 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 8.400e-97
Identity = 169/239 (70.71%), Postives = 187/239 (78.24%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKASGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIKTDWTQAPFTASYRNFNANACVWXXXXXXXXXXXXXPWFSQELDTXGQERLKWVQKNYMIYNYCKDSKRFPQGLPKEC 718
            I N GQLLSLSLDK SGSGF+SK EYLFG+IDMQLKLV GNSAGTVTAYYL S G T DEIDFEFLGNLSGDPY LHTN+FT GKG+REQQF+LWFDPT +FHTYS++W PQ I+F VD +PIR FKN E  GV FPKNQPMRIYSSLWNADDWATRGGL+KTDW++APFTA YRNF A                   + + ELD   + RL+WVQK +MIYNYC D KRFPQGLP EC
Sbjct:   47 IFNGGQLLSLSLDKVSGSGFKSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNIFTQGKGNREQQFYLWFDPTRNFHTYSIIWKPQHIIFLVDNTPIRVFKNAEPLGVPFPKNQPMRIYSSLWNADDWATRGGLVKTDWSKAPFTAYYRNFKA----IEFSSKSSISNSGAEYEANELDAYSRRRLRWVQKYFMIYNYCSDLKRFPQGLPAEC 281          
The following BLAST results are available for this feature:
BLAST of DC899998 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 54
Match NameE-valueIdentityDescription
XTH23_ARATH2.200e-11377.78Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH22_ARATH6.625e-11073.77Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH24_ARATH8.098e-10874.90Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH25_ARATH1.169e-10674.06Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH20_ARATH2.136e-10068.07Xyloglucan endotransglucosylase/hydrolase protein ... [more]
XTH21_ARATH4.759e-10066.14Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH19_ARATH3.085e-9968.07Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH17_ARATH1.999e-9868.22Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH18_ARATH2.611e-9867.93Probable xyloglucan endotransglucosylase/hydrolase... [more]
BRU1_SOYBN8.400e-9770.71Brassinosteroid-regulated protein BRU1 OS=Glycine ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899998 VSS Citrus sinensis cDNA clone VS27Q09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899998 ID=DC899998|Name=DC899998|organism=Citrus sinensis|type=EST|length=870bp
GATACTCAACAACGGCCAGCTTCTCTCCCTCTCCCTTGACAAAGCCTCAG
GCTCAGGCTTCCAGTCCAAGAGCGAGTACCTTTTTGGCAAAATCGACATG
CAACTCAAGCTTGTCCCTGGCAATTCTGCCGGCACAGTCACCGCCTACTA
CTTAAAATCACCAGGATCAACATGGGATGAGATAGACTTTGAATTCTTGG
GGAATTTAAGTGGTGATCCTTATACTCTTCATACTAATGTGTTCACAAAT
GGCAAAGGTGACAGAGAGCAACAATTCCACCTCTGGTTTGACCCCACTGC
TGACTTTCACACCTATTCCGTTCTCTGGAACCCCCAACGTATTGTCTTCT
ATGTTGATGGCTCGCCAATTAGAGAGTTCAAGAACTTGGAATCAAACGGC
GTACTCTTTCCCAAAAACCAGCCGATGAGGATTTACTCGAGTCTCTGGAA
CGCCGATGACTGGGCCACGAGAGGTGGCCTTATCAAAACTGACTGGACCC
AAGCTCCCTTCACTGCTTCTTACAGAAACTTCAATGCCAATGCTTGCGTC
TGGTCTAATGGAAAATCCTCTTGCAACTCAAAAAATAATAATCCATGGTT
CTCGCAAGAACTTGATACCNCTGGCCAAGAGAGACTCAAATGGGTGCAGA
AGAATTACATGATATATAATTATTGCAAGGACTCAAAACGATTTCCCCAA
GGGCTCCCAAAAGAATGTGCATTCAATATATAACTGATCCATTTGCCATA
TGTCTTTGTTTATAGCTTTTTTAATCTTCAGTTTTGATGTTTTGGTTCTT
TTATTCTGTGTACTAATGTTTAGTGACAAATAAAATGTATGGTTCATTCT
TTTTTGTACTATAAGTGCTA
back to top