CN185539

Overview
NameCN185539
Unique NameCN185539
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185539 vs. ExPASy Swiss-Prot
Match: SRG1_ARATH (Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.607e-24
Identity = 60/150 (40.00%), Postives = 90/150 (60.00%), Query Frame = 1
Query:   19 MAKSLKLEENCFLNQFGNQSQYQA-RFNYYAHCQRPDLVLGLKPHSDGTGYTIVLQ--DEEGLQVLKDEQWFTVPKISEAVLVLMGDQMEIMTNGIFKSPVHRVVTSAEKERFSVVVFYAPELNKEIGPENGLINEECPRLFK--NMKDY 453
            MA++L+++       F +    Q+ R NYY  C +PD V+GL PHSD  G T+++Q  D EGLQ+ KD +W  V  +  A +V +GD +EI+TNG ++S  HR V ++EKER S+  F+   + KE+GP   L+  +    FK   MK+Y
Sbjct:  189 MARALEIKPEELEKLFDDVDSVQSMRMNYYPPCPQPDQVIGLTPHSDSVGLTVLMQVNDVEGLQIKKDGKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHRGVVNSEKERLSIATFHNVGMYKEVGPAKSLVERQKVARFKRLTMKEY 338          
BLAST of CN185539 vs. ExPASy Swiss-Prot
Match: FLS_EUSGR (Flavonol synthase/flavanone 3-hydroxylase OS=Eustoma grandiflorum GN=FLS PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.320e-23
Identity = 65/152 (42.76%), Postives = 87/152 (57.24%), Query Frame = 1
Query:   13 KAMAKSLKLEENCFLNQFGNQSQ-YQARFNYYAHCQRPDLVLGLKPHSDGTGYTIVLQDE-EGLQVLKDEQWFTVPKISEAVLVLMGDQMEIMTNGIFKSPVHRVVTSAEKERFSVVVFYAPELNKEIGPENGLINEECPRLF--KNMKDYA 456
            K ++  L LE N F +  G     Y  + NYY  C RPDL LG+  H+D +  T+++ +E  GLQV KD  W+    I  A++V +GDQ+EIM+NG +KS  HR   + EK R S  VF  P  + E+GP   L+NEE P  F  K  KDYA
Sbjct:  175 KYLSLGLDLEPNSFKDGAGGDDLVYLMKINYYPPCPRPDLALGV-AHTDMSAITVLVPNEVPGLQVYKDGHWYDCKYIPNALIVHIGDQVEIMSNGKYKSVYHRTTVNKEKTRMSWPVFLEPPPDHEVGPIPKLVNEENPAKFKTKKYKDYA 325          
BLAST of CN185539 vs. ExPASy Swiss-Prot
Match: FLS_PETHY (Flavonol synthase/flavanone 3-hydroxylase OS=Petunia hybrida GN=FL PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.749e-22
Identity = 54/128 (42.19%), Postives = 77/128 (60.16%), Query Frame = 1
Query:   67 GNQSQYQARFNYYAHCQRPDLVLGLKPHSDGTGYTIVLQDE-EGLQVLKDEQWFTVPKISEAVLVLMGDQMEIMTNGIFKSPVHRVVTSAEKERFSVVVFYAPELNKEIGPENGLINEECPRLFKNMK 447
            G++  Y  + NYY  C RPDL LG+  H+D +  TI++ +E +GLQV KD  W+ V  I  A++V +GDQ+EI++NG +KS  HR   + +K R S  VF  P    E+GP   L++E  P  FK  K
Sbjct:  207 GDEIVYLLKINYYPPCPRPDLALGVVAHTDMSYITILVPNEVQGLQVFKDGHWYDVKYIPNALIVHIGDQVEILSNGKYKSVYHRTTVNKDKTRMSWPVFLEPPSEHEVGPIPKLLSEANPPKFKTKK 334          
BLAST of CN185539 vs. ExPASy Swiss-Prot
Match: FLS_PETCR (Flavonol synthase/flavanone 3-hydroxylase OS=Petroselinum crispum GN=FLS PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.273e-21
Identity = 54/128 (42.19%), Postives = 76/128 (59.38%), Query Frame = 1
Query:   67 GNQSQYQARFNYYAHCQRPDLVLGLKPHSDGTGYTIVLQDE-EGLQVLKDEQWFTVPKISEAVLVLMGDQMEIMTNGIFKSPVHRVVTSAEKERFSVVVFYAPELNKEIGPENGLINEECPRLFKNMK 447
            G+   Y  + NYY  C RPDL LG+  H+D +  TI++ +E +GLQV KD+ W+ V  I  A+++ +GDQ+EIM+NG +KS  HR   + +K R S  VF  P      GP + LI +E P  FK  K
Sbjct:  196 GDDLIYMLKINYYPPCPRPDLALGVVAHTDMSAITILVPNEVQGLQVHKDDHWYDVKYIPNALIIHIGDQIEIMSNGKYKSVYHRTTVNKDKTRMSWPVFLEPPPELLTGPISKLITDENPAKFKTKK 323          
BLAST of CN185539 vs. ExPASy Swiss-Prot
Match: FLS1_ARATH (Flavonol synthase/flavanone 3-hydroxylase OS=Arabidopsis thaliana GN=FLS1 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.837e-21
Identity = 54/133 (40.60%), Postives = 77/133 (57.89%), Query Frame = 1
Query:   67 GNQSQYQARFNYYAHCQRPDLVLGLKPHSDGTGYTIVLQDE-EGLQVLKDEQWFTVPKISEAVLVLMGDQMEIMTNGIFKSPVHRVVTSAEKERFSVVVFYAPELNKEIGPENGLINEECPRLFK--NMKDYA 456
            G  ++Y  + NYY  C RPDL LG+  H+D +G T+++ +E  GLQV KD+ WF    I  AV+V +GDQ+  ++NG +K+ +HR     EK R S  VF  P   K +GP   L  ++ P  FK    KDY+
Sbjct:  194 GEMAEYMMKINYYPPCPRPDLALGVPAHTDLSGITLLVPNEVPGLQVFKDDHWFDAEYIPSAVIVHIGDQILRLSNGRYKNVLHRTTVDKEKTRMSWPVFLEPPREKIVGPLPELTGDDNPPKFKPFAFKDYS 326          
BLAST of CN185539 vs. ExPASy Swiss-Prot
Match: FLS_CITUN (Flavonol synthase/flavanone 3-hydroxylase OS=Citrus unshiu GN=FLS PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.705e-21
Identity = 50/133 (37.59%), Postives = 81/133 (60.90%), Query Frame = 1
Query:   67 GNQSQYQARFNYYAHCQRPDLVLGLKPHSDGTGYTIVLQDE-EGLQVLKDEQWFTVPKISEAVLVLMGDQMEIMTNGIFKSPVHRVVTSAEKERFSVVVFYAPELNKEIGPENGLINEECPRLF--KNMKDYA 456
            G+  +Y  + NYY  C RPDL LG+  H+D +  T+++ +E  GLQV KD++W     I  A+++ +GDQ+EI++NG +K+ +HR   + +K R S  VF  P  +  +GP   L+++E P  +  K  KDY+
Sbjct:  194 GDDIEYMLKINYYPPCPRPDLALGVVAHTDLSALTVLVPNEVPGLQVFKDDRWIDAKYIPNALVIHIGDQIEILSNGKYKAVLHRTTVNKDKTRMSWPVFLEPPADTVVGPLPQLVDDENPPKYKAKKFKDYS 326          
BLAST of CN185539 vs. ExPASy Swiss-Prot
Match: FLS_SOLTU (Flavonol synthase/flavanone 3-hydroxylase OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.838e-21
Identity = 56/146 (38.36%), Postives = 83/146 (56.85%), Query Frame = 1
Query:   13 KAMAKSLKLEENCFLNQFGNQS-QYQARFNYYAHCQRPDLVLGLKPHSDGTGYTIVLQDEEGLQVLKDEQWFTVPKISEAVLVLMGDQMEIMTNGIFKSPVHRVVTSAEKERFSVVVFYAPELNKEIGPENGLINEECPRLFKNMK 447
            ++++  L LE +  +   G++   Y  + NYY  C RPDL LG+  H+D +  T+++ +E  +QV KD  W+ V  I  A++V +GDQ+EI++NG +KS  HR   +  K R S  VF  P    E+GP   LINE  P  FK  K
Sbjct:  192 RSLSLGLGLEGHEMMEAAGSEDIVYMLKINYYPPCPRPDLALGVVAHTDMSYITLLVPNE--VQVFKDGHWYDVNYIPNAIIVHIGDQVEILSNGKYKSVYHRTTVNKYKTRMSWPVFLEPSSEHEVGPIPNLINEANPPKFKTKK 335          
BLAST of CN185539 vs. ExPASy Swiss-Prot
Match: ACCO1_SOLLC (1-aminocyclopropane-1-carboxylate oxidase 1 OS=Solanum lycopersicum GN=ACO1 PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 4.838e-21
Identity = 50/138 (36.23%), Postives = 82/138 (59.42%), Query Frame = 1
Query:   19 MAKSLKLEENCFLNQFGNQS--QYQARFNYYAHCQRPDLVLGLKPHSDGTGYTIVLQDEE--GLQVLKDEQWFTVPKISEAVLVLMGDQMEIMTNGIFKSPVHRVVTSAEKERFSVVVFYAPELNKEIGPENGLINEE 420
            + ++L LE+    N F       +  + + Y  C +PDL+ GL+ H+D  G  ++ QD++  GLQ+LKDEQW  VP +  +++V +GDQ+E++TNG +KS +HRV+   +  R S+  FY P  +  I P   L+ +E
Sbjct:  132 LCENLGLEKGYLKNAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDEQWIDVPPMRHSIVVNLGDQLEVITNGKYKSVLHRVIAQTDGTRMSLASFYNPGSDAVIYPAKTLVEKE 269          
BLAST of CN185539 vs. ExPASy Swiss-Prot
Match: ACCO_MUSAC (1-aminocyclopropane-1-carboxylate oxidase OS=Musa acuminata GN=MAO1B PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 6.319e-21
Identity = 55/161 (34.16%), Postives = 89/161 (55.28%), Query Frame = 1
Query:   13 KAMAKSLKLEENCFLNQFGNQSQYQARF----NYYAHCQRPDLVLGLKPHSDGTGYTIVLQDEE--GLQVLKDEQWFTVPKISEAVLVLMGDQMEIMTNGIFKSPVHRVVTSAEKERFSVVVFYAPELNKEIGPENGLINEEC--PRLFKN--MKDYANIH 465
            + M ++L  E+ C    F    Q+   F    ++Y  C R DLV GL+ H+D  G  ++ QD++  GLQ+LKD +W  V  +++A+++  GDQ+E+++NG +KS  HRV+ ++   R S+  FY P L   I P  G   EE   P L+      DY +++
Sbjct:  128 EVMDENLGFEKGCIKKAFSGDGQHPPFFGTKVSHYPPCPRLDLVKGLRAHTDAGGVILLFQDDQVGGLQMLKDGRWIDVQPLADAIVINTGDQIEVLSNGRYKSAWHRVLATSHGNRRSIASFYNPSLKATIAPAAGAATEEAAPPALYPKFLFGDYMDVY 288          
BLAST of CN185539 vs. ExPASy Swiss-Prot
Match: ACCO4_SOLLC (1-aminocyclopropane-1-carboxylate oxidase 4 OS=Solanum lycopersicum GN=ACO4 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 6.319e-21
Identity = 51/137 (37.23%), Postives = 81/137 (59.12%), Query Frame = 1
Query:   19 MAKSLKLEENCFLNQFGNQS--QYQARFNYYAHCQRPDLVLGLKPHSDGTGYTIVLQDEE--GLQVLKDEQWFTVPKISEAVLVLMGDQMEIMTNGIFKSPVHRVVTSAEKERFSVVVFYAPELNKEIGPENGLINE 417
            + ++L LE+    N F       +  + + Y  C +PDL+ GL+ H+D  G  ++ QD++  GLQ+LKDEQW  VP +  +++V +GDQ+E++TNG +KS +HRV+   +  R S+  FY P  +  I P   LI E
Sbjct:  132 LCENLGLEKGYLKNAFYGSKGPNFGTKVSNYPPCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDEQWIDVPPMRHSIVVNLGDQLEVITNGKYKSVMHRVIAQTDGTRMSLASFYNPGNDAVIYPAPSLIEE 268          
The following BLAST results are available for this feature:
BLAST of CN185539 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 79
Match NameE-valueIdentityDescription
SRG1_ARATH1.607e-2440.00Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 ... [more]
FLS_EUSGR2.320e-2342.76Flavonol synthase/flavanone 3-hydroxylase OS=Eusto... [more]
FLS_PETHY9.749e-2242.19Flavonol synthase/flavanone 3-hydroxylase OS=Petun... [more]
FLS_PETCR1.273e-2142.19Flavonol synthase/flavanone 3-hydroxylase OS=Petro... [more]
FLS1_ARATH2.837e-2140.60Flavonol synthase/flavanone 3-hydroxylase OS=Arabi... [more]
FLS_CITUN3.705e-2137.59Flavonol synthase/flavanone 3-hydroxylase OS=Citru... [more]
FLS_SOLTU4.838e-2138.36Flavonol synthase/flavanone 3-hydroxylase OS=Solan... [more]
ACCO1_SOLLC4.838e-2136.231-aminocyclopropane-1-carboxylate oxidase 1 OS=Sol... [more]
ACCO_MUSAC6.319e-2134.161-aminocyclopropane-1-carboxylate oxidase OS=Musa ... [more]
ACCO4_SOLLC6.319e-2137.231-aminocyclopropane-1-carboxylate oxidase 4 OS=Sol... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H24_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H24, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185539 ID=CN185539|Name=CN185539|organism=Citrus sinensis|type=EST|length=670bp
ATGATCACTTCCAAAGCCATGGCAAAGTCATTGAAGTTAGAGGAAAATTG
CTTCCTGAATCAGTTTGGGAATCAATCACAGTATCAAGCGAGGTTTAACT
ATTATGCACATTGTCAGAGACCTGATCTTGTCCTGGGCTTAAAACCCCAT
TCAGATGGAACCGGATACACCATTGTATTGCAGGACGAAGAAGGTCTCCA
AGTCCTCAAAGATGAGCAATGGTTTACAGTACCCAAAATATCTGAAGCTG
TCCTAGTCCTCATGGGTGACCAAATGGAGATAATGACTAATGGAATCTTC
AAGAGCCCAGTGCATAGAGTAGTTACTAGTGCAGAAAAGGAGAGGTTTTC
TGTAGTAGTATTTTATGCACCAGAATTGAACAAGGAGATTGGACCAGAAA
ATGGCTTAATCAACGAGGAATGCCCAAGATTATTCAAGAACATGAAAGAT
TACGCCAATATTCACTGGGAATACTACCAGAAAGGACAGCGAGCACTTCA
CACCGCAAAAGGGTGATATTGTCCTGTAGCATACTGATAGAATAGTCTCA
TGTTCTGTCACTTCTTTATCCTTCCATCTTTCTTTTCCTTCTTCGTTTTG
TGTGGTTGTGAAACTTAATCCTAGAGCTTTTAAATAAACACTACCTTATG
GGTGAAAAAAAAAAAAAAAA
back to top