CN185473

Overview
NameCN185473
Unique NameCN185473
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length688
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185473 vs. ExPASy Swiss-Prot
Match: PPIL3_RHIOR (Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rhizopus oryzae GN=cyp4 PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.424e-55
Identity = 110/166 (66.27%), Postives = 122/166 (73.49%), Query Frame = 1
Query:   10 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXXXXXX------SIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFE-VLDLMEKAQTGSGDRPLAEIRINRVTIHANPLA 486
            MSVTLHT+LGDIK E+ C+ VPKTAENFLALCASGYYD   FHRNI GFMIQ                  SIWGKKFNDEIR +LKHN+RGI+SMANSGPNTNGSQFFI+YAK PHL+  YTVFG+VI G +  LD+MEK       RPL E RI  VTIHANP+A
Sbjct:    1 MSVTLHTDLGDIKIEVFCEAVPKTAENFLALCASGYYDNNTFHRNIPGFMIQVHEHLHTGDPTGTGKGGNSIWGKKFNDEIRSTLKHNSRGIVSMANSGPNTNGSQFFITYAKHPHLDTKYTVFGKVIDGADSTLDMMEKVPVDEKHRPLQEFRIKSVTIHANPIA 166          
BLAST of CN185473 vs. ExPASy Swiss-Prot
Match: PPIL3_CRYNE (Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans GN=CYP10 PE=3 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 5.971e-54
Identity = 99/159 (62.26%), Postives = 123/159 (77.36%), Query Frame = 1
Query:   10 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXXXXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLA 486
            MSVTLHTNLGDIK E+ C+ VP+TAENFLALCASG YDGT+FHRNI+GFMIQ            SIWG+ F+DEIR++L+ N RG+++MAN+GP+TN SQFFI+YAKQP L+G Y++FG+VI G E LD MEK       RPL EI++  VT+HANP+A
Sbjct:    1 MSVTLHTNLGDIKIELFCESVPRTAENFLALCASGQYDGTLFHRNIRGFMIQGGDPTGTGKGGQSIWGRPFSDEIRQTLRFNNRGMVAMANAGPDTNKSQFFITYAKQPSLDGKYSIFGKVIDGMETLDSMEKTPVNPKSRPLQEIKLLNVTVHANPIA 159          
BLAST of CN185473 vs. ExPASy Swiss-Prot
Match: PPIL3_DICDI (Peptidyl-prolyl cis-trans isomerase-like 3 OS=Dictyostelium discoideum GN=ppil3 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 6.602e-53
Identity = 104/159 (65.41%), Postives = 115/159 (72.33%), Query Frame = 1
Query:   10 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXXXXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLA 486
            MSVTLHT+LGDIK EI CD VP  +ENFLALCAS YY+ TIFHRNIKGFMIQ            SIW K+F DE    LKHN RGILSMANSGP+TNGSQFFI+Y K   LN +YTVFG++I G EVLDLMEK      D PL EI +  VTIHANP+A
Sbjct:    1 MSVTLHTSLGDIKVEIFCDSVPLASENFLALCASNYYNNTIFHRNIKGFMIQGGDPTNTGRGGESIWKKQFKDEFPSHLKHNTRGILSMANSGPDTNGSQFFITYGKHRSLNKVYTVFGKIIAGIEVLDLMEKVPVDDKDLPLNEIILKSVTIHANPIA 159          
BLAST of CN185473 vs. ExPASy Swiss-Prot
Match: PPIL3_HUMAN (Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo sapiens GN=PPIL3 PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 8.623e-53
Identity = 100/160 (62.50%), Postives = 116/160 (72.50%), Query Frame = 1
Query:   10 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXXXXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGD-RPLAEIRINRVTIHANPLA 486
            MSVTLHT++GDIK E+ C+  PKT ENFLALCAS YY+G IFHRNIKGFM+Q            SIWGKKF DE  E LKHN RG++SMAN+GPNTNGSQFFI+Y KQPHL+  YTVFG+VI G E LD +EK        RPL ++ I  +TIHANP A
Sbjct:    1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA 160          
BLAST of CN185473 vs. ExPASy Swiss-Prot
Match: PPIL3_RAT (Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rattus norvegicus GN=Ppil3 PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.126e-52
Identity = 99/160 (61.88%), Postives = 116/160 (72.50%), Query Frame = 1
Query:   10 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXXXXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGD-RPLAEIRINRVTIHANPLA 486
            MSVTLHT++GDIK E+ C+  PKT ENFLALCAS YY+G +FHRNIKGFM+Q            SIWGKKF DE  E LKHN RG++SMAN+GPNTNGSQFFI+Y KQPHL+  YTVFG+VI G E LD +EK        RPL ++ I  +TIHANP A
Sbjct:    1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA 160          
BLAST of CN185473 vs. ExPASy Swiss-Prot
Match: PPIL3_MOUSE (Peptidyl-prolyl cis-trans isomerase-like 3 OS=Mus musculus GN=Ppil3 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.589e-52
Identity = 98/160 (61.25%), Postives = 115/160 (71.88%), Query Frame = 1
Query:   10 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXXXXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGD-RPLAEIRINRVTIHANPLA 486
            MSVTLHT++GDIK E+ C+  PKT ENFLALCAS YY+G +FHRNIKGFM+Q            SIW KKF DE  E LKHN RG++SMAN+GPNTNGSQFFI+Y KQPHL+  YTVFG+VI G E LD +EK        RPL ++ I  +TIHANP A
Sbjct:    1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIWAKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA 160          
BLAST of CN185473 vs. ExPASy Swiss-Prot
Match: PPIL3_CHICK (Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gallus gallus GN=PPIL3 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 7.300e-52
Identity = 97/161 (60.25%), Postives = 117/161 (72.67%), Query Frame = 1
Query:   10 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXXXXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGD-RPLAEIRINRVTIHANPLAV 489
            M+VTLHT++GDIK E+ C+  PKT ENFLALCAS YY+G +FHRNIKGFM+Q            SIWGKKF DE  E LKH+ RG++SMAN+GPNTNGSQFFI+Y KQPHL+  YTVFG+VI G E LD +EK        RPL ++ I  +TIHANP A+
Sbjct:    1 MAVTLHTDVGDIKIELFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPLGTGKGGTSIWGKKFEDEFSEYLKHSVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAL 161          
BLAST of CN185473 vs. ExPASy Swiss-Prot
Match: PPIL3_USTMA (Peptidyl-prolyl cis-trans isomerase-like 3 OS=Ustilago maydis GN=CYP10 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.687e-46
Identity = 92/163 (56.44%), Postives = 114/163 (69.94%), Query Frame = 1
Query:   10 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXXXXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFE---VLDLMEKAQTGSGDRPLAEIRINRVTIHANPLAV 489
            MSVTLHTN+GDIK E+ CD  P+ AENFL  CA+G Y+   +HRNIK FMIQ            SIWGK F DEIR SLK + RGI++ AN+GP+TN SQFFI+YAKQPHL+G YT+ G+VI G E    LD ME     + +RP +EIR+  VT+HANP+A+
Sbjct:    1 MSVTLHTNVGDIKVEVFCDATPRAAENFLGHCAAGTYNDVKWHRNIKSFMIQTGDPTGTGKGGQSIWGKPFADEIRSSLKFDRRGIVACANAGPDTNKSQFFITYAKQPHLDGKYTIIGKVIDGAEDGGTLDAMEAIPVDAKNRPTSEIRMTGVTVHANPIAI 163          
BLAST of CN185473 vs. ExPASy Swiss-Prot
Match: CYP10_CAEEL (Peptidyl-prolyl cis-trans isomerase 10 OS=Caenorhabditis elegans GN=cyn-10 PE=2 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 1.741e-45
Identity = 89/159 (55.97%), Postives = 112/159 (70.44%), Query Frame = 1
Query:   10 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXXXXXXSIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVIHGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLA 486
            MSVTLHT  GDIK E+  D+ PK  ENFLALCAS YY+G IFHRNIK FM+Q            SIWG  F DE   +LKH++RG +SMAN+GP++N SQFFI+YAKQ HL+  YT+FG+VI GF+ L+ +E  +  +  RPL + +I  VTIHANP+A
Sbjct:    1 MSVTLHTTSGDIKIELYVDDAPKACENFLALCASDYYNGCIFHRNIKDFMVQTGDPTHSGKGGESIWGGPFEDEFVSALKHDSRGCVSMANNGPDSNRSQFFITYAKQAHLDMKYTLFGKVIDGFDTLEEIETIKVDNKYRPLVQQKIQNVTIHANPMA 159          
BLAST of CN185473 vs. ExPASy Swiss-Prot
Match: PPIL3_GIBZE (Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gibberella zeae GN=CYP10 PE=3 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 8.643e-45
Identity = 97/166 (58.43%), Postives = 109/166 (65.66%), Query Frame = 1
Query:   10 MSVTLHTNLGDIKCEIACDEVPKTAENFLALCASGYYDGTIFHRNIKGFMIQXXXXXXXXXXXX-----SIWGKKFNDEIRESLKHNARGILSMANSGPNTNGSQFFISYAKQPHLNGLYTVFGRVI--HGFEVLDLMEKAQTGSGDRPLAEIRINRVTIHANPLA 486
            MSVTLHT+ GDIK EI C+ VPKTAENFLALC SGYYD + FHR I  FM Q                 SIWG  F DEIR +L+H ARG+LSMAN GP TNGSQFFI++ K PHL+GL TVFGRVI   G   L  ME  +    +RP   +RI  VTIHANPLA
Sbjct:    1 MSVTLHTSHGDIKVEIYCESVPKTAENFLALCGSGYYDKSPFHRVIPKFMAQTGAPATPNPPENPKGGRSIWGGAFEDEIRPALRHGARGVLSMANKGPGTNGSQFFITFDKAPHLDGLNTVFGRVIGDEGLATLAKMEAVEVDRKNRPKEPVRIENVTIHANPLA 166          
The following BLAST results are available for this feature:
BLAST of CN185473 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
PPIL3_RHIOR2.424e-5566.27Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rhiz... [more]
PPIL3_CRYNE5.971e-5462.26Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryp... [more]
PPIL3_DICDI6.602e-5365.41Peptidyl-prolyl cis-trans isomerase-like 3 OS=Dict... [more]
PPIL3_HUMAN8.623e-5362.50Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo... [more]
PPIL3_RAT1.126e-5261.88Peptidyl-prolyl cis-trans isomerase-like 3 OS=Ratt... [more]
PPIL3_MOUSE5.589e-5261.25Peptidyl-prolyl cis-trans isomerase-like 3 OS=Mus ... [more]
PPIL3_CHICK7.300e-5260.25Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gall... [more]
PPIL3_USTMA2.687e-4656.44Peptidyl-prolyl cis-trans isomerase-like 3 OS=Usti... [more]
CYP10_CAEEL1.741e-4555.97Peptidyl-prolyl cis-trans isomerase 10 OS=Caenorha... [more]
PPIL3_GIBZE8.643e-4558.43Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gibb... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001G07_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001G07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185473 ID=CN185473|Name=CN185473|organism=Citrus sinensis|type=EST|length=688bp
AGGGGTAAGATGTCGGTAACTCTACACACTAATCTGGGTGATATTAAGTG
CGAGATTGCTTGCGACGAAGTCCCTAAGACGGCTGAGAATTTTTTGGCAC
TATGCGCGAGTGGTTACTACGATGGGACCATTTTTCACCGGAATATTAAA
GGTTTTATGATTCAAGGTGGAGACCCAACAGGCACTGGAAAAGGCGGAAC
AAGCATATGGGGCAAGAAGTTCAATGATGAGATAAGGGAGTCCCTCAAGC
ATAATGCTAGAGGGATACTGTCAATGGCCAATAGTGGCCCTAACACTAAT
GGAAGCCAATTCTTCATCTCTTATGCAAAGCAGCCCCATCTTAACGGATT
GTACACTGTGTTTGGTAGAGTAATTCATGGGTTCGAAGTTCTTGACCTTA
TGGAAAAGGCTCAAACTGGATCAGGGGACCGGCCACTTGCGGAGATAAGG
ATCAATCGAGTTACCATACATGCTAACCCACTTGCTGTCTAGCTTTGTCT
GAAAATTTCTTGTTGTATAACATTGTAAAGAGGCTTAGTGTGGAGTGGGA
ACAGTGACTTACGATTAAACTCCCAGTAGACTCTGTACATTTTTCTTTTC
CCAGTTATGACTATGGGCTTGAAGGAAGAAGTAACCGCAGAATTTTATGT
AGCATCAAATGGTGAGATTGACGATTGAGAAAAAAAAA
back to top