CN185397

Overview
NameCN185397
Unique NameCN185397
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length742
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6857 contig Csv1_Contig6857:25..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_NEUCR (2-nitropropane dioxygenase OS=Neurospora crassa GN=ncd-2 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.748e-20
Identity = 64/190 (33.68%), Postives = 103/190 (54.21%), Query Frame = 3
Query:  183 RKTRSLTERPF----GVGVVLAFPHNENIKAILSEKVAVL-----QVSW---------------GEYSEELVLEA-HSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGHVIGQ-DGLISLLPMVVDLIG----DRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLV 662
            R    LT+RP     G+GV L   H  ++  +    + +L     Q  W                + + + ++EA H++G  V  QVG+  +ARKA   G D I+ QG +AGGH +    G++SL+P V D++     +R++ ++AAGG+ D RG V AL LGA+G+ L TRF  + E+ + PE++RK++
Sbjct:   83 RSRLGLTDRPLTPLPGIGVGLILTHTISVPYVTDTVLPILIEHSPQAVWLFANDPDFEASSEPGAKGTAKQIIEALHASGFVVFFQVGTVKDARKAAADGADVIVAQGIDAGGHQLATGSGIVSLVPEVRDMLDREFKEREVVVVAAGGVADGRGVVGALGLGAEGVVLGTRFTVAVEA-STPEFRRKVI 271          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAT (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=USA300HOU_0879 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.173e-19
Identity = 55/152 (36.18%), Postives = 90/152 (59.21%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I  I+ ++V V   ++G  SE+++    +A VK++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAE (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain Newman) GN=NWMN_0792 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.173e-19
Identity = 55/152 (36.18%), Postives = 90/152 (59.21%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I  I+ ++V V   ++G  SE+++    +A VK++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAC (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain COL) GN=SACOL0922 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.173e-19
Identity = 55/152 (36.18%), Postives = 90/152 (59.21%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I  I+ ++V V   ++G  SE+++    +A VK++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAA8 (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00855 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.173e-19
Identity = 55/152 (36.18%), Postives = 90/152 (59.21%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I  I+ ++V V   ++G  SE+++    +A VK++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAA3 (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0825 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.173e-19
Identity = 55/152 (36.18%), Postives = 90/152 (59.21%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I  I+ ++V V   ++G  SE+++    +A VK++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_BACSU (Probable 2-nitropropane dioxygenase OS=Bacillus subtilis GN=yrpB PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.412e-19
Identity = 75/258 (29.07%), Postives = 118/258 (45.74%), Query Frame = 3
Query:   54 IVQAPLGPDISGPEXXXXXXXXXXXXXXRAPDWEAPDYLRDLIRKTRSLTERPFGVGVV----LAFPHNENIK------------------------------AILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH------VIGQD--GLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDK--TEYTDVF 695
            I+QAP+   I+ P                A  +  PD L   I++   LT+ PF + V     L  P  + IK                               IL  KV     ++    E+ V E  +AG  ++    + +EA      G+D +++QG EAGGH        G+   GL++L+P   D +    +P+IAAGG++D RG  AAL+LGAQG+ + + F+   ES AHP +K+K++E ++  T+ T +F
Sbjct:   14 IIQAPMAGGITKPRLASAVSNQGALGSL-ASGYLTPDLLEQQIKEIFELTDAPFQINVFVPLGLEMPPKDQIKKWKENIPLANQVNQFTSVQEEWDDFYQKIDLILKYKVKACSFTFDLPPEDAVKELKTAGCCLIGTASTVEEALLMEERGMDIVVLQGSEAGGHRGAFLPSKGESAVGLMALIPQAADAL---SVPVIAAGGMIDHRGVKAALTLGAQGVQIGSAFLICHESNAHPVHKQKILEANEADTKLTTLF 267          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAS (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0791 PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 9.231e-19
Identity = 54/152 (35.53%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I  I+ ++V V   ++G  SE ++     A +K++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPSESIIKRLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAR (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0883 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.056e-18
Identity = 53/152 (34.87%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I  I+ ++V V   ++G  +E ++     A +K++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPNESIIKRLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAN (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain N315) GN=SA0781 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.686e-18
Identity = 53/152 (34.87%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I  I+ ++V V   ++G  +E ++     A +K++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPNESIIERLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
The following BLAST results are available for this feature:
BLAST of CN185397 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
2NPD_NEUCR3.748e-2033.682-nitropropane dioxygenase OS=Neurospora crassa GN... [more]
2NPD_STAAT3.173e-1936.18Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAAE3.173e-1936.18Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAAC3.173e-1936.18Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAA83.173e-1936.18Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAA33.173e-1936.18Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_BACSU5.412e-1929.07Probable 2-nitropropane dioxygenase OS=Bacillus su... [more]
2NPD_STAAS9.231e-1935.53Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAAR2.056e-1834.87Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAAN2.686e-1834.87Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001E10_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001E10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185397 ID=CN185397|Name=CN185397|organism=Citrus sinensis|type=EST|length=742bp
ATTTGAAGTTTACTCTAATGGGTTGGAGAGGAATGCTGGCTTTCAAGTAT
GGGATTGTTCAGGCACCATTGGGACCTGATATTTCAGGCCCGGAGCTTGT
AGCTGCTGTTGCTAATGCCGGTGGTCTTGGTCTTCTTAGAGCCCCCGATT
GGGAAGCACCAGATTACTTGAGGGATCTGATAAGGAAGACAAGATCATTA
ACAGAGCGACCATTTGGGGTTGGTGTGGTTCTAGCATTTCCCCACAACGA
AAATATAAAGGCTATACTTAGTGAAAAAGTAGCAGTTTTGCAAGTTTCCT
GGGGTGAATATTCAGAGGAGCTCGTTCTTGAAGCTCATAGTGCTGGAGTC
AAAGTTGTCCCCCAAGTTGGGAGTTTTGACGAAGCAAGAAAAGCAGTTAA
CGCAGGTGTAGATGCAATTATAGTCCAAGGACGTGAAGCTGGGGGCCATG
TAATTGGACAGGATGGTTTGATTTCCTTATTGCCAATGGTGGTTGATCTT
ATCGGGGATCGAGATATTCCAATAATTGCTGCAGGTGGTATTGTGGATGC
ACGTGGTTATGTTGCAGCCCTGTCTCTTGGTGCTCAAGGCATCTGCTTAT
GCACAAGGTTTGTGGCAAGTGAGGAAAGCTATGCGCATCCTGAGTACAAG
AGAAAGTTGGTTGAAATGGACAAAACTGAATATACAGATGTATTTGGCAG
GGCAAGATGGCCCGGTGCACCCCACCGTGTGCTGCAAACACC
back to top