CN185388

Overview
NameCN185388
Unique NameCN185388
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length728
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN185388_ssr25 microsatellite CN185388_ssr25:25..46. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2479 contig Csv1_Contig2479:1..728. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185388 vs. ExPASy Swiss-Prot
Match: NTF2_ARATH (Nuclear transport factor 2 OS=Arabidopsis thaliana GN=NTF2 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.365e-59
Identity = 109/125 (87.20%), Postives = 117/125 (93.60%), Query Frame = 1
Query:  127 NQMDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNYA 501
            +QMDPD+V+KAFVEHYY+TFD NR GLA LYQE SMLTFEGQKIQG Q+IVAKLTSLPFQQC+H I+TVDCQPSGPA GMLVFVSGNLQLAGE+HALKFSQMFHLMPTPQGSFYV NDIFRLNYA
Sbjct:    2 SQMDPDAVSKAFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQQCKHHISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIFRLNYA 126          
BLAST of CN185388 vs. ExPASy Swiss-Prot
Match: NTF2_ORYSJ (Nuclear transport factor 2 OS=Oryza sativa subsp. japonica GN=NTF2 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.378e-42
Identity = 83/122 (68.03%), Postives = 95/122 (77.87%), Query Frame = 1
Query:  133 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNY 498
            MD D+VAKAFVEHYY TFD NR  L +LYQ+GSMLTFEGQ+  G+  I  KL SLPF QC H I TVDCQPSGP GGMLVFVSG+L+   ++H LKFSQMF L+P   G+FYV ND+FRLNY
Sbjct:    1 MDADAVAKAFVEHYYRTFDTNRPALVSLYQDGSMLTFEGQQFLGAAAIAGKLGSLPFAQCHHDINTVDCQPSGPQGGMLVFVSGSLRTGPDEHPLKFSQMFQLLPA-GGNFYVQNDMFRLNY 121          
BLAST of CN185388 vs. ExPASy Swiss-Prot
Match: NTF2_ASHGO (Nuclear transport factor 2 OS=Ashbya gossypii GN=NTF2 PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 4.139e-32
Identity = 67/123 (54.47%), Postives = 92/123 (74.80%), Query Frame = 1
Query:  133 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNYA 501
            MD  ++A+ F E YY  FD +R+ L NLY++ SMLTFE  ++QG+++IV KL SLPFQ+ QH ITT+D QP+ P G +LV ++G+L +  EQ+A +FSQ+FHLMP    S+YV NDIFRLNY+
Sbjct:    3 MDFSALAQQFTEFYYNQFDTDRSQLGNLYRDQSMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPNGDVLVMITGDLLIDDEQNAQRFSQVFHLMP-EGNSYYVFNDIFRLNYS 124          
BLAST of CN185388 vs. ExPASy Swiss-Prot
Match: NTF2_KLULA (Nuclear transport factor 2 OS=Kluyveromyces lactis GN=NTF2 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.683e-31
Identity = 67/123 (54.47%), Postives = 91/123 (73.98%), Query Frame = 1
Query:  133 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNYA 501
            +D  S+A+ F E YY  FD++RT L NLY+E SMLTFE  ++QG+++IV KL SLPFQ+  H ITT+D QP+ P G +LV ++G+L +  EQ+  +FSQ+FHLMP    S+YV NDIFRLNY+
Sbjct:    3 VDFSSLAQQFTEFYYNQFDSDRTQLGNLYREQSMLTFETTQLQGAKDIVEKLVSLPFQKVAHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLMP-EGSSYYVYNDIFRLNYS 124          
BLAST of CN185388 vs. ExPASy Swiss-Prot
Match: NTF2_EMENI (Nuclear transport factor 2 OS=Emericella nidulans GN=ntf2 PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.504e-31
Identity = 66/121 (54.55%), Postives = 86/121 (71.07%), Query Frame = 1
Query:  136 DPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNY 498
            D  S+A+ FV  YY TFD NR GLA LY++ SMLTFE   IQG   I+ KLTSLPFQ+ QH ++T+D QPSG  GG+LV V+G L +  E++ + ++Q F LMP   GS++VLND+FRL Y
Sbjct:    3 DFQSIAQQFVTFYYQTFDGNRAGLAPLYRDHSMLTFETSAIQGVAGIIEKLTSLPFQKVQHQVSTLDAQPSGEHGGILVLVTGALLVDEEKNPMNYTQTFQLMPDGAGSYFVLNDVFRLIY 123          
BLAST of CN185388 vs. ExPASy Swiss-Prot
Match: NTF2_CANGA (Nuclear transport factor 2 OS=Candida glabrata GN=NTF2 PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.331e-30
Identity = 64/123 (52.03%), Postives = 92/123 (74.80%), Query Frame = 1
Query:  133 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNYA 501
            MD +++A+ F E YY  FD++R+ L NLY++ SMLTFE  ++QG+++IV KL SLPFQ+  H ITT+D QP+ P G +LV ++G+L +  EQ+  +FSQ+FHL+P    S+YV NDIFRLNY+
Sbjct:    3 MDFNALAQQFTEFYYNQFDSDRSQLGNLYRDESMLTFETSQLQGAKSIVEKLVSLPFQKVAHRITTLDAQPASPNGDVLVMITGDLLIDDEQNPQRFSQVFHLIP-DGNSYYVFNDIFRLNYS 124          
BLAST of CN185388 vs. ExPASy Swiss-Prot
Match: NTF2_YEAST (Nuclear transport factor 2 OS=Saccharomyces cerevisiae GN=NTF2 PE=1 SV=2)

HSP 1 Score: 131.339 bits (329), Expect = 5.059e-30
Identity = 63/123 (51.22%), Postives = 91/123 (73.98%), Query Frame = 1
Query:  133 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNYA 501
            +D +++A+ F + YY  FD +R+ L NLY+  SMLTFE  ++QG+++IV KL SLPFQ+ QH ITT+D QP+ P G +LV ++G+L +  EQ+  +FSQ+FHL+P    S+YV NDIFRLNY+
Sbjct:    3 LDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLIP-DGNSYYVFNDIFRLNYS 124          
BLAST of CN185388 vs. ExPASy Swiss-Prot
Match: NTF2_SCHPO (Nuclear transport factor 2 OS=Schizosaccharomyces pombe GN=ntf2 PE=2 SV=2)

HSP 1 Score: 130.954 bits (328), Expect = 6.607e-30
Identity = 63/121 (52.07%), Postives = 92/121 (76.03%), Query Frame = 1
Query:  136 DPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNY 498
            D +++A  F + YY TFD++R+ L++LY+E SML+FEG ++QG++ IV KL SLPFQ+ QH I+T+D QP+G  G ++V V+G L L  EQ A ++SQ+FHL+    G++YVLND+FRLNY
Sbjct:    3 DYNALATQFTQFYYQTFDSDRSQLSSLYREESMLSFEGAQLQGTKAIVEKLVSLPFQRVQHRISTLDAQPTGTTGSVIVMVTGELLLDEEQMAQRYSQVFHLV-NNNGNYYVLNDLFRLNY 122          
BLAST of CN185388 vs. ExPASy Swiss-Prot
Match: NTF2_DEBHA (Nuclear transport factor 2 OS=Debaryomyces hansenii GN=NTF2 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.607e-30
Identity = 65/123 (52.85%), Postives = 89/123 (72.36%), Query Frame = 1
Query:  133 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNYA 501
            +D ++VA  F   YY  FD++RT L NLY+E SMLTFE  ++QG+++IV KL SLPFQ+  H I+T+D QP  P G +LV V+G L +  EQ+A ++SQ+FHL+P    S+YV NDIFRLNY+
Sbjct:    3 VDFNTVASEFCNFYYQQFDSDRTQLGNLYREQSMLTFETSQLQGAKDIVEKLVSLPFQKVAHRISTLDAQPGSPNGDILVMVTGELIIDDEQNAQRYSQVFHLIP-DGNSYYVFNDIFRLNYS 124          
BLAST of CN185388 vs. ExPASy Swiss-Prot
Match: NTF2_CANAL (Nuclear transport factor 2 OS=Candida albicans GN=NTF2 PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.594e-29
Identity = 63/123 (51.22%), Postives = 89/123 (72.36%), Query Frame = 1
Query:  133 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNYA 501
            +D ++VA  F   YY  FD++R+ L NLY+  SMLTFE  ++QG+++IV KL SLPFQ+  H I+T+D QP+   G +LV V+G L +  EQ+A ++SQ+FHL+P   GS+YV NDIFRLNY+
Sbjct:    3 VDFNAVATEFCNFYYNQFDSDRSQLGNLYRNESMLTFETSQLQGARDIVEKLASLPFQKVAHRISTLDAQPASANGDILVMVTGELLIDEEQNAQRYSQVFHLIP-DNGSYYVFNDIFRLNYS 124          
The following BLAST results are available for this feature:
BLAST of CN185388 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
NTF2_ARATH1.365e-5987.20Nuclear transport factor 2 OS=Arabidopsis thaliana... [more]
NTF2_ORYSJ3.378e-4268.03Nuclear transport factor 2 OS=Oryza sativa subsp. ... [more]
NTF2_ASHGO4.139e-3254.47Nuclear transport factor 2 OS=Ashbya gossypii GN=N... [more]
NTF2_KLULA2.683e-3154.47Nuclear transport factor 2 OS=Kluyveromyces lactis... [more]
NTF2_EMENI3.504e-3154.55Nuclear transport factor 2 OS=Emericella nidulans ... [more]
NTF2_CANGA1.331e-3052.03Nuclear transport factor 2 OS=Candida glabrata GN=... [more]
NTF2_YEAST5.059e-3051.22Nuclear transport factor 2 OS=Saccharomyces cerevi... [more]
NTF2_SCHPO6.607e-3052.07Nuclear transport factor 2 OS=Schizosaccharomyces ... [more]
NTF2_DEBHA6.607e-3052.85Nuclear transport factor 2 OS=Debaryomyces hanseni... [more]
NTF2_CANAL5.594e-2951.22Nuclear transport factor 2 OS=Candida albicans GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001E05_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001E05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185388 ID=CN185388|Name=CN185388|organism=Citrus sinensis|type=EST|length=728bp
AGGCCCAAACGAAATCTGAGAGCGCTCTCTCTCTCTCTCTCTCTCTCGTT
AGCGTGAGTCTCAAGCGGAAACAGCAAACGCAAAATTCGAAAAGAGAGGC
AGGGGTAGGAGGGGATTTTGAAATTCAATCAGATGGATCCAGACTCAGTG
GCTAAAGCCTTCGTCGAGCACTACTACACGACGTTTGATGCCAATCGTAC
GGGGCTCGCCAATCTCTATCAGGAAGGTTCAATGTTGACTTTTGAAGGTC
AAAAAATCCAAGGCTCGCAAAACATCGTCGCTAAGCTCACTAGCCTTCCC
TTCCAGCAGTGCCAGCACTCCATCACCACCGTCGATTGCCAGCCCTCCGG
TCCCGCTGGCGGCATGCTCGTTTTTGTCTCCGGTAATCTCCAACTCGCTG
GTGAACAGCACGCTCTCAAGTTCAGCCAGATGTTCCATTTGATGCCAACA
CCTCAGGGAAGCTTTTATGTGTTGAATGACATATTCAGGTTGAACTATGC
ATGAAGAGAAGATTGATTGAAAAGGGATGCAACTCCTGAAGGAGTGAAAC
ATGTTTCCTTATCTTTATTGGATTTTAAACATTTAAATGAACACTGGGTT
TTTCTGTGGTCGGTTATGTTTAAGGTTCCCTTGTGCCTTTCCTGAACTTT
AAATAGAGACATCTTTTCTGTGATTGGTTGAGTAACTGCAAGATCTCCCT
GAAGAAGTTGGGTCTTAGTGAAATGAAT
back to top