CN185380

Overview
NameCN185380
Unique NameCN185380
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length654
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN185380 vs. ExPASy Swiss-Prot
Match: ACA8_ARATH (Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 6.239e-34
Identity = 65/93 (69.89%), Postives = 78/93 (83.87%), Query Frame = -2
Query:  120 QIFNEFNARKPDEKNLFKGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFISGPLAILGKLIPVPATPFSNIFNIFK 398
            Q FNEFNARKPDEKN+FKG+ KNRLFMGI+ +TLVLQ++I++FLGKFASTT+LNWK W+I V IG IS PLA++GK IPVPA P SN   + K
Sbjct:  968 QAFNEFNARKPDEKNIFKGVIKNRLFMGIIVITLVLQVIIVEFLGKFASTTKLNWKQWLICVGIGVISWPLALVGKFIPVPAAPISNKLKVLK 1060          
BLAST of CN185380 vs. ExPASy Swiss-Prot
Match: ACA10_ARATH (Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.590e-29
Identity = 55/91 (60.44%), Postives = 77/91 (84.62%), Query Frame = -2
Query:  126 QIFNEFNARKPDEKNLFKGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFISGPLAILGKLIPVPATPFSNIFNI 398
            Q+FNEFNARKPDE N+F+G+ +N LF+GI+++T+VLQ++I++FLG FASTT+L+W+ W++ + IG IS PLA++GKLIPVP TP S  F I
Sbjct:  970 QVFNEFNARKPDEINIFRGVLRNHLFVGIISITIVLQVVIVEFLGTFASTTKLDWEMWLVCIGIGSISWPLAVIGKLIPVPETPVSQYFRI 1060          
BLAST of CN185380 vs. ExPASy Swiss-Prot
Match: ACA9_ARATH (Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 7.893e-29
Identity = 58/89 (65.17%), Postives = 71/89 (79.78%), Query Frame = -2
Query:  132 QIFNEFNARKPDEKNLFKGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFISGPLAILGKLIPVPATPFSNIF 398
            QIFNEFNARKPDE N+F+G+ KN LF+ IV VT +LQI+I+ FLGKFA T RL W+ W+ S++IG +S PLAI+GKLIPVP TP S  F
Sbjct:  985 QIFNEFNARKPDEMNVFRGVNKNPLFVAIVGVTFILQIIIVTFLGKFAHTVRLGWQLWLASIIIGLVSWPLAIVGKLIPVPKTPMSVYF 1073          
BLAST of CN185380 vs. ExPASy Swiss-Prot
Match: ACA12_ARATH (Putative calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 7.911e-21
Identity = 44/89 (49.44%), Postives = 65/89 (73.03%), Query Frame = -2
Query:  132 QIFNEFNARKPDEKNLFKGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFISGPLAILGKLIPVPATPFSNIF 398
            Q+FNEFNAR+ ++KN+FKG+ +NRLF+GI+A+T+VLQ+++++FL KFA T RLN   W   + +  +S P+    K IPV  TPF + F
Sbjct:  927 QVFNEFNAREMEKKNVFKGLHRNRLFIGIIAITIVLQVIMVEFLKKFADTVRLNGWQWGTCIALASLSWPIGFFTKFIPVSETPFLSYF 1015          
BLAST of CN185380 vs. ExPASy Swiss-Prot
Match: ACA13_ARATH (Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 9.670e-19
Identity = 43/85 (50.59%), Postives = 61/85 (71.76%), Query Frame = -2
Query:  144 QIFNEFNARKPDEKNLFKGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFISGPLAILGKLIPVPATPF 398
            Q+FNEFNAR  ++KN+FKG+ KNRLF+GI+ VT+VLQ+++++FL +FA T RLN   W + + I   S P+  L K +PVP   F
Sbjct:  923 QVFNEFNARSLEKKNVFKGLHKNRLFIGIIVVTVVLQVVMVEFLKRFADTERLNLGQWGVCIAIAAASWPIGWLVKSVPVPERHF 1007          
BLAST of CN185380 vs. ExPASy Swiss-Prot
Match: ACA5_ORYSJ (Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.930e-17
Identity = 38/80 (47.50%), Postives = 59/80 (73.75%), Query Frame = -2
Query:  159 QIFNEFNARKPDEKNLFKGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFISGPLAILGKLIPV 398
            Q+FNE N+R+  + N+F+GI  N +F+ ++A T+  Q++II+FLG FAST  LNW+HW++SV +G IS  + ++ K IPV
Sbjct:  916 QVFNEINSREMQKINVFRGIISNWIFIAVIAATVAFQVVIIEFLGTFASTVPLNWQHWLLSVGLGSISLIVGVILKCIPV 995          
BLAST of CN185380 vs. ExPASy Swiss-Prot
Match: ACA4_ORYSJ (Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.930e-17
Identity = 38/80 (47.50%), Postives = 59/80 (73.75%), Query Frame = -2
Query:  159 QIFNEFNARKPDEKNLFKGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFISGPLAILGKLIPV 398
            Q+FNE N+R+  + N+F+GI  N +F+ ++A T+  Q++II+FLG FAST  LNW+HW++SV +G IS  + ++ K IPV
Sbjct:  938 QVFNEINSREMQKINVFRGIISNWIFIAVIAATVAFQVVIIEFLGTFASTVPLNWQHWLLSVGLGSISLIVGVILKCIPV 1017          
BLAST of CN185380 vs. ExPASy Swiss-Prot
Match: ACA4_ARATH (Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.492e-16
Identity = 40/105 (38.10%), Postives = 73/105 (69.52%), Query Frame = -2
Query:  159 TVIKLDG-----LTNR*LFEM----QIFNEFNARKPDEKNLFKGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFISGPLAILGKLIPV 446
            +++KLDG     + N  +F      Q+FNE N+R+ ++ N+FKG+  + +F  ++ VT+V Q++I++FLG FAST  L+W+HW++S++IG ++  +A++ K +PV
Sbjct:  904 SLLKLDGPDSTAVLNTVIFNSFVFCQVFNEINSREIEKINVFKGMFNSWVFTWVMTVTVVFQVIIVEFLGAFASTVPLSWQHWLLSILIGSLNMIVAVILKCVPV 1008          
BLAST of CN185380 vs. ExPASy Swiss-Prot
Match: ACA1_ARATH (Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3)

HSP 1 Score: 82.8037 bits (203), Expect = 1.707e-15
Identity = 35/80 (43.75%), Postives = 59/80 (73.75%), Query Frame = -2
Query:  159 QIFNEFNARKPDEKNLFKGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFISGPLAILGKLIPV 398
            Q+FNE ++R+ ++ ++FKGI KN +F+ ++  T+V Q++II+ LG FA TT LN   W++S+++GF+  P+A   K+IPV
Sbjct:  938 QVFNEISSREMEKIDVFKGILKNYVFVAVLTCTVVFQVIIIELLGTFADTTPLNLGQWLVSIILGFLGMPVAAALKMIPV 1017          
BLAST of CN185380 vs. ExPASy Swiss-Prot
Match: ACA11_ARATH (Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.106e-14
Identity = 34/80 (42.50%), Postives = 60/80 (75.00%), Query Frame = -2
Query:  159 QIFNEFNARKPDEKNLFKGITKNRLFMGIVAVTLVLQILIIQFLGKFASTTRLNWKHWIISVVIGFISGPLAILGKLIPV 398
            Q+FNE N+R+ ++ N+F+G+ K+ +F+ ++  T+  Q++I++FLG FAST  L+W+HW++ ++IG +S  LA+  K IPV
Sbjct:  926 QVFNEVNSREIEKINVFEGMFKSWVFVAVMTATVGFQVIIVEFLGAFASTVPLSWQHWLLCILIGSVSMILAVGLKCIPV 1005          
The following BLAST results are available for this feature:
BLAST of CN185380 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
ACA8_ARATH6.239e-3469.89Calcium-transporting ATPase 8, plasma membrane-typ... [more]
ACA10_ARATH1.590e-2960.44Calcium-transporting ATPase 10, plasma membrane-ty... [more]
ACA9_ARATH7.893e-2965.17Calcium-transporting ATPase 9, plasma membrane-typ... [more]
ACA12_ARATH7.911e-2149.44Putative calcium-transporting ATPase 12, plasma me... [more]
ACA13_ARATH9.670e-1950.59Putative calcium-transporting ATPase 13, plasma me... [more]
ACA5_ORYSJ6.930e-1747.50Probable calcium-transporting ATPase 5, plasma mem... [more]
ACA4_ORYSJ6.930e-1747.50Probable calcium-transporting ATPase 4, plasma mem... [more]
ACA4_ARATH4.492e-1638.10Calcium-transporting ATPase 4, plasma membrane-typ... [more]
ACA1_ARATH1.707e-1543.75Calcium-transporting ATPase 1, chloroplastic OS=Ar... [more]
ACA11_ARATH1.106e-1442.50Putative calcium-transporting ATPase 11, plasma me... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001E01_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001E01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185380 ID=CN185380|Name=CN185380|organism=Citrus sinensis|type=EST|length=654bp
AGGAAAAAGGACAGCACATTCTACAAAGGCTGAAATATTGACAAACCAAG
TGATCCAGATGAATCCGGGCACCTTCCCATTGGTTAACTTTCCTAATTTC
TTTGTTGAGAACGTCTTCTTTTGAATATATTGAAGATATTACTGAAGGGA
GTTGCTGGCACAGGTATCAATTTCCCCAGAATAGCGAGGGGCCCACTGAT
GAAGCCAATGACGACAGAAATAATCCAGTGCTTCCAATTAAGCCTGGTAG
TTGATGCGAACTTCCCAAGAAACTGAATGATAAGTATCTGAAGTACAAGA
GTTACTGCCACTATCCCCATAAAAAGACGGTTCTTAGTAATTCCTTTGAA
AAGATTTTTTTCATCGGGCTTCCGAGCATTAAATTCATTAAAGATCTGCA
TTTCAAACAATTACCTGTTTGTCAGGCCATCCAATTTTATGACAGTTACA
AACCAACAATGCCGGGAAAAAAAACACTTCTAGCAGTGACAATGCTAGCA
GCATCAAGCTGCCCTCGAAACCACAACAAACAGAAGCTCAACTTAACAAA
TTATTGTATTCCCTGATGATTTACTAACCTGGCAAAGGACAAAAGAATTG
AATATCAGAGTATTTTTTACTTTGTTGGAATGGGCATTGGAATCACTCTC
CAGG
back to top