CN185247

Overview
NameCN185247
Unique NameCN185247
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length430
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2542 contig Csv1_Contig2542:360..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX4_CITSI (Probable phospholipid hydroperoxide glutathione peroxidase OS=Citrus sinensis GN=CSA PE=1 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 7.157e-68
Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLET 370
            TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLET
Sbjct:   44 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLET 166          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX4_MESCR (Probable phospholipid hydroperoxide glutathione peroxidase OS=Mesembryanthemum crystallinum GN=GPXMC1 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.332e-57
Identity = 102/123 (82.93%), Postives = 115/123 (93.50%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLET 370
            TNSNY EL++LY++YK++GLEILAFPCNQFG QEPGDNEQI EFACTRFKAEFPIFDKVDVNG NAAP+YK+LKSSKGGLFGD IKWNF+KFLVD++G VV+RYAPTTSP SIEKDIKKL+ T
Sbjct:   47 TNSNYPELTKLYEQYKDKGLEILAFPCNQFGNQEPGDNEQIMEFACTRFKAEFPIFDKVDVNGSNAAPVYKYLKSSKGGLFGDGIKWNFTKFLVDRDGKVVDRYAPTTSPASIEKDIKKLIGT 169          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX6_ARATH (Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial OS=Arabidopsis thaliana GN=GPX6 PE=2 SV=2)

HSP 1 Score: 218.009 bits (554), Expect = 1.266e-56
Identity = 101/121 (83.47%), Postives = 112/121 (92.56%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            TNSNYTEL+QLY+KYK  G EILAFPCNQFG QEPG NE+I +FACTRFKAE+PIFDKVDVNGD AAP+YK LKSSKGGLFGD IKWNF+KFLVDK+GNVV+R+APTTSPLSIEKD+KKLL
Sbjct:  108 TNSNYTELAQLYEKYKGHGFEILAFPCNQFGNQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDKAAPVYKFLKSSKGGLFGDGIKWNFAKFLVDKDGNVVDRFAPTTSPLSIEKDVKKLL 228          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX4_SPIOL (Probable phospholipid hydroperoxide glutathione peroxidase OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 6.285e-56
Identity = 98/121 (80.99%), Postives = 112/121 (92.56%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            TNSNYTE+++LY+KY+  GLEILAFPCNQFG QEPG NE++ EFACTRFKAE+PIFDKVDVNG NAAP+YK LKSSKGGLFGD +KWNF+KFLVDK+GNVV+RYAPTTSP SIEKD+KKLL
Sbjct:   47 TNSNYTEMTELYEKYRELGLEILAFPCNQFGNQEPGSNEEVLEFACTRFKAEYPIFDKVDVNGSNAAPIYKFLKSSKGGLFGDGLKWNFTKFLVDKDGNVVDRYAPTTSPKSIEKDVKKLL 167          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX4_NICSY (Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 6.285e-56
Identity = 100/121 (82.64%), Postives = 111/121 (91.74%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            TNSNYT+L+++Y KYK+QGLEILAFPCNQFG QEPG  E+IQ   CTRFKAE+PIFDKVDVNGDNAAPLYK LKSSKGG FGDSIKWNFSKFLVDKEGNVV+RY+PTT+P S+EKDIKKLL
Sbjct:   46 TNSNYTDLTEIYKKYKDQGLEILAFPCNQFGGQEPGSIEEIQNMVCTRFKAEYPIFDKVDVNGDNAAPLYKFLKSSKGGFFGDSIKWNFSKFLVDKEGNVVDRYSPTTTPASMEKDIKKLL 166          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX4_TOBAC (Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.072e-55
Identity = 99/121 (81.82%), Postives = 111/121 (91.74%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            TNSNYT+++++Y KYK+QGLEILAFPCNQFG QEPG  E+IQ   CTRFKAE+PIFDKVDVNGDNAAPLYK LKSSKGG FGDSIKWNFSKFLVDKEGNVV+RY+PTT+P S+EKDIKKLL
Sbjct:   46 TNSNYTDMTEIYKKYKDQGLEILAFPCNQFGGQEPGSIEEIQNMVCTRFKAEYPIFDKVDVNGDNAAPLYKFLKSSKGGFFGDSIKWNFSKFLVDKEGNVVDRYSPTTTPASMEKDIKKLL 166          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX4_SOLLC (Probable phospholipid hydroperoxide glutathione peroxidase OS=Solanum lycopersicum GN=GPXle-1 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 6.948e-55
Identity = 97/121 (80.17%), Postives = 111/121 (91.74%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            TNSNYT++++LY KYK+QGLEILAFPCNQFG QEPG+ E IQ+  CTRFKAE+PIFDKVDVNGDNAAPLY+ LKSSKGG FGD IKWNFSKFL+DKEG+VV+RY+PTTSP S+EKDIKKLL
Sbjct:   46 TNSNYTDMTELYKKYKDQGLEILAFPCNQFGGQEPGNIEDIQQMVCTRFKAEYPIFDKVDVNGDNAAPLYRFLKSSKGGFFGDGIKWNFSKFLIDKEGHVVDRYSPTTSPASMEKDIKKLL 166          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX4_GOSHI (Probable phospholipid hydroperoxide glutathione peroxidase OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.185e-54
Identity = 100/122 (81.97%), Postives = 110/122 (90.16%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGD-NEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            TNSNYT+L+++Y KYK+QGLEILAFPCNQFG QEPG   E IQ   CTRFKAE+PIFDKVDVNGDNAAPLYK LKSSKGG FGDSIKWNFSKFLVDKEGNVV+RY+PTT+P S+EKDIKKLL
Sbjct:   46 TNSNYTDLTEIYKKYKDQGLEILAFPCNQFGGQEPGSIEESIQNMVCTRFKAEYPIFDKVDVNGDNAAPLYKFLKSSKGGFFGDSIKWNFSKFLVDKEGNVVDRYSPTTTPASMEKDIKKLL 167          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX4_HELAN (Probable phospholipid hydroperoxide glutathione peroxidase OS=Helianthus annuus GN=GPXHA-2 PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 4.980e-53
Identity = 97/121 (80.17%), Postives = 106/121 (87.60%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            TNSNY EL+ LY KYK+QG EILAFPCNQFG QEPG NE+IQ FACTRFKAE+P+F KV+VNG  A PLYK LKSSKGG  GDSIKWNF+KFLVD+EG VV+RYAPTTSPLSIEKDIKKLL
Sbjct:   57 TNSNYPELTTLYQKYKDQGFEILAFPCNQFGGQEPGSNEEIQVFACTRFKAEYPVFSKVNVNGKEADPLYKFLKSSKGGFLGDSIKWNFTKFLVDREGKVVDRYAPTTSPLSIEKDIKKLL 177          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_PEA (Phospholipid hydroperoxide glutathione peroxidase, chloroplastic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 6.087e-51
Identity = 91/121 (75.21%), Postives = 104/121 (85.95%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T+SNYTELS LY+ +KN+GLE+LAFPCNQFG QEPG NE+I++FACT+FKAEFPIFDKVDVNG   AP+Y+ LKSS GG FGD +KWNF KFLVDK G VVERY PTTSP  IEKDI+KLL
Sbjct:  114 TSSNYTELSHLYENFKNKGLEVLAFPCNQFGMQEPGSNEEIKQFACTKFKAEFPIFDKVDVNGPFTAPVYQFLKSSSGGFFGDIVKWNFEKFLVDKNGKVVERYPPTTSPFQIEKDIQKLL 234          
The following BLAST results are available for this feature:
BLAST of CN185247 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
GPX4_CITSI7.157e-68100.00Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_MESCR3.332e-5782.93Probable phospholipid hydroperoxide glutathione pe... [more]
GPX6_ARATH1.266e-5683.47Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_SPIOL6.285e-5680.99Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_NICSY6.285e-5682.64Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_TOBAC1.072e-5581.82Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_SOLLC6.948e-5580.17Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_GOSHI1.185e-5481.97Probable phospholipid hydroperoxide glutathione pe... [more]
GPX4_HELAN4.980e-5380.17Probable phospholipid hydroperoxide glutathione pe... [more]
GPX1_PEA6.087e-5175.21Phospholipid hydroperoxide glutathione peroxidase,... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A17_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185247 ID=CN185247|Name=CN185247|organism=Citrus sinensis|type=EST|length=430bp
GACCAATTCAAACTACACTGAGCTGAGTCAGTTGTACGACAAGTACAAGA
ATCAAGGCTTGGAGATTCTGGCCTTTCCTTGTAATCAGTTTGGAGCTCAA
GAGCCAGGAGACAATGAACAGATTCAAGAATTTGCATGCACTCGCTTTAA
GGCTGAGTTTCCCATATTTGATAAGGTTGATGTTAATGGTGATAATGCTG
CTCCTTTATACAAGCATCTGAAATCCAGCAAAGGTGGACTTTTTGGAGAC
AGCATCAAGTGGAACTTTTCCAAGTTCTTGGTGGATAAGGAGGGGAATGT
TGTTGAGCGTTATGCCCCCACCACTAGCCCTCTGAGCATTGAGAAGGATA
TAAAGAAACTTCTGGAGACTGCTTAACCGCTGCTACAACTTGCATGATCA
GCTTCTTGCTAATAAAACTAGAGTATCATG
back to top