DC887617
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DC887617 vs. ExPASy Swiss-Prot
Match: AP1M2_HUMAN (AP-1 complex subunit mu-2 OS=Homo sapiens GN=AP1M2 PE=1 SV=4) HSP 1 Score: 78.5666 bits (192), Expect = 1.351e-14 Identity = 37/55 (67.27%), Postives = 44/55 (80.00%), Query Frame = -3 Query: 283 KQLLRERLPYV*NXKIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELR 447 K+ + R P +IPYFTVSGIQVRY+KIIEKSGY ALPWVRYIT +G+Y+LR Sbjct: 367 KEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR 421
BLAST of DC887617 vs. ExPASy Swiss-Prot
Match: AP1M2_BOVIN (AP-1 complex subunit mu-2 OS=Bos taurus GN=AP1M2 PE=1 SV=3) HSP 1 Score: 78.5666 bits (192), Expect = 1.351e-14 Identity = 37/55 (67.27%), Postives = 44/55 (80.00%), Query Frame = -3 Query: 283 KQLLRERLPYV*NXKIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELR 447 K+ + R P +IPYFTVSGIQVRY+KIIEKSGY ALPWVRYIT +G+Y+LR Sbjct: 367 KEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR 421
BLAST of DC887617 vs. ExPASy Swiss-Prot
Match: AP1M_CAEEL (AP-1 complex subunit mu-1-I OS=Caenorhabditis elegans GN=unc-101 PE=2 SV=2) HSP 1 Score: 78.1814 bits (191), Expect = 1.765e-14 Identity = 37/50 (74.00%), Postives = 40/50 (80.00%), Query Frame = -3 Query: 280 RLPYV*NXKIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELRL 429 R P +IPYFT SGIQVRYLKIIEKSGY ALPWVRYIT GEYE+R+ Sbjct: 372 RPPIKVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGEYEMRM 421
BLAST of DC887617 vs. ExPASy Swiss-Prot
Match: AP1M2_MOUSE (AP-1 complex subunit mu-2 OS=Mus musculus GN=Ap1m2 PE=1 SV=3) HSP 1 Score: 77.411 bits (189), Expect = 3.010e-14 Identity = 34/41 (82.93%), Postives = 39/41 (95.12%), Query Frame = -3 Query: 283 KIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELR 405 +IPYFTVSGIQVRY+KIIEKSGY ALPWVRYIT +G+Y+LR Sbjct: 381 EIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLR 421
BLAST of DC887617 vs. ExPASy Swiss-Prot
Match: AP1M1_RAT (AP-1 complex subunit mu-1 OS=Rattus norvegicus GN=Ap1m1 PE=1 SV=3) HSP 1 Score: 75.485 bits (184), Expect = 1.144e-13 Identity = 34/41 (82.93%), Postives = 37/41 (90.24%), Query Frame = -3 Query: 283 KIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELR 405 +IPYFT SGIQVRYLKIIEKSGY ALPWVRYIT G+Y+LR Sbjct: 381 EIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR 421
BLAST of DC887617 vs. ExPASy Swiss-Prot
Match: AP1M1_MOUSE (AP-1 complex subunit mu-1 OS=Mus musculus GN=Ap1m1 PE=1 SV=3) HSP 1 Score: 75.485 bits (184), Expect = 1.144e-13 Identity = 34/41 (82.93%), Postives = 37/41 (90.24%), Query Frame = -3 Query: 283 KIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELR 405 +IPYFT SGIQVRYLKIIEKSGY ALPWVRYIT G+Y+LR Sbjct: 381 EIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR 421
BLAST of DC887617 vs. ExPASy Swiss-Prot
Match: AP1M1_HUMAN (AP-1 complex subunit mu-1 OS=Homo sapiens GN=AP1M1 PE=1 SV=3) HSP 1 Score: 75.485 bits (184), Expect = 1.144e-13 Identity = 34/41 (82.93%), Postives = 37/41 (90.24%), Query Frame = -3 Query: 283 KIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELR 405 +IPYFT SGIQVRYLKIIEKSGY ALPWVRYIT G+Y+LR Sbjct: 381 EIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR 421
BLAST of DC887617 vs. ExPASy Swiss-Prot
Match: AP1M1_BOVIN (AP-1 complex subunit mu-1 OS=Bos taurus GN=AP1M1 PE=1 SV=3) HSP 1 Score: 75.485 bits (184), Expect = 1.144e-13 Identity = 34/41 (82.93%), Postives = 37/41 (90.24%), Query Frame = -3 Query: 283 KIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELR 405 +IPYFT SGIQVRYLKIIEKSGY ALPWVRYIT G+Y+LR Sbjct: 381 EIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR 421
BLAST of DC887617 vs. ExPASy Swiss-Prot
Match: AP1M_DICDI (AP-1 complex subunit mu OS=Dictyostelium discoideum GN=apm1 PE=1 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.548e-13 Identity = 32/47 (68.09%), Postives = 40/47 (85.11%), Query Frame = -3 Query: 283 PYV*NXKIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELR 423 P + +IPY+TVSGIQVRYLKIIEKSGY ALPWVRY+ ++G+Y+ R Sbjct: 380 PIMVKFEIPYYTVSGIQVRYLKIIEKSGYQALPWVRYVCLSGDYQFR 426 The following BLAST results are available for this feature:
BLAST of DC887617 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 9
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DC887617 ID=DC887617; Name=DC887617; organism=Citrus sinensis; type=EST; length=449bpback to top |